CAZyme Information: MGYG000002946_01651

Basic Information

• Species: Enterocloster sp900555905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555905
• CAZyme ID: MGYG000002946_01651
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		50969.04	5.0474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002946	4682631	MAG	United States	North America

• Gene Location: Start: 6613; End: 7980 Strand: -

Full Sequence      

MIYTENKCRDINICYIGGGSQGWAWKLMSDLFLEESLSGTVRLYDIDEEASKANEAIGNR
LSGQNGAKGEWKYISVPTLEEGLKGADFVIISILPATFEEMDSDVHAPEKYGIYQSVGDT
TGPGGVFRALRTIPMYDVIADGIREYCPEAWVINYTNPMALCVGALYHRYPKIKAFGCCH
EVFGAQRLLLMALKEVEGIEVEDRHQLRTNVAGINHFTWITGASWRNVDLMPVYRTFAEA
HFEEGICDKITDVHFMSKNRVKFDLFRKHGAIAAAGDRHLAEFIPEYVRDPETVSRWNYS
LTPVSYRVENKKMLNEKSRAYAAGEIEIPVEPSGEEGVAQMKALLGLGDLITNVNLPNTG
QMDAGRGIVVETNALFTYNSVRPLIAGGLPDSVELYMNRHMKNQALLLKAAVNRDKELAF
YVFRNDPMVSGLTYADAAQLFDEMFDNTRAYLPGY

Enzyme Prediction     

No EC number prediction in MGYG000002946_01651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	13	189	6.5e-56	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.16e-148	11	446	1	421	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.46e-97	9	455	2	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	2.14e-73	13	455	4	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	7.64e-59	13	195	2	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	6.63e-38	11	444	1	422	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD02978.1	1.72e-206	1	455	1	453
ADL69862.1	1.02e-195	1	452	1	448
AGB20015.1	1.18e-194	1	452	1	448
AST57057.1	1.36e-193	1	452	1	448
SNX53397.1	9.36e-192	1	455	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	6.09e-146	11	443	6	434	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.96e-21	9	455	3	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1OBB_A	1.23e-19	11	427	4	449	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1S6Y_A	1.89e-19	9	455	6	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
6DUX_A	4.83e-15	5	453	1	440	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3T426	3.45e-207	1	455	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
I3VRU1	9.43e-191	1	455	1	461	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
A9KTB9	2.96e-165	1	453	1	461	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	4.19e-150	11	444	10	439	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	2.54e-47	13	455	4	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002946_01651.