CAZyme Information: MGYG000002946_02126

Basic Information

• Species: Enterocloster sp900555905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555905
• CAZyme ID: MGYG000002946_02126
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002946_224|CGC1	32878.81	4.651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002946	4682631	MAG	United States	North America

• Gene Location: Start: 406; End: 1296 Strand: +

Full Sequence      

MVGYYPDWKGYQPEKLHFDVLTHVVYAFAIPTPDGDLLPLEQPETAKRLIKDAHDNQVKV
LLAVGGWSHNGAELEPVFMSATADADKLRAFGDKIVAMCEQYGFDGIDMDWEHPRVDGTS
KDQYRELMLYLADRLHGRGKLLTSAVISGVSADGNIYYDAAAHSDEVLNAVDWIHVMAYD
GGDGERHSPFEFAVNCGEYWHTTRNMPREKVVLGLPFYGRPGWASYEEILAADPQAYAGD
HAAINGTDVWYNGVAAVEQKARYAGEHLGGVMIWELTQDTSDREKSLLLAVGRGLN

Enzyme Prediction     

No EC number prediction in MGYG000002946_02126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	284	2.7e-53	0.9425675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	4.40e-52	2	291	2	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	2.43e-50	2	279	3	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.69e-49	2	279	3	334	Glyco_18 domain.
cd06548	GH18_chitinase	3.38e-41	2	279	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	1.29e-36	1	282	1	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP38084.1	5.34e-168	1	295	147	441
ASN97117.1	5.34e-168	1	295	147	441
QJU18460.1	1.07e-167	1	295	147	441
QNM13846.1	6.77e-128	1	296	149	444
BCJ98260.1	3.43e-114	1	292	14	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	3.94e-26	1	288	19	298	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
5XWQ_A	1.33e-22	3	291	6	365	Crystalstructure of chitinase (RmChi1) from Rhizomucor miehei (sp p32 2 1, MR) [Rhizomucor miehei],5YUQ_A Chain A, Chintase [Rhizomucor miehei],5YUQ_B Chain B, Chintase [Rhizomucor miehei],7FBT_A Chain A, Chitinase [Rhizomucor miehei]
6JM7_A	5.46e-22	1	220	6	252	Crystalstructure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
3WL1_A	1.43e-21	1	250	9	292	Crystalstructure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3W4R_A	3.02e-21	1	250	27	310	Crystalstructure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95M17	1.09e-21	1	279	24	365	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
P36362	6.21e-19	1	220	25	272	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q13231	3.09e-18	1	220	24	269	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
P20533	3.19e-18	1	223	46	342	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
G5EAZ3	4.07e-18	2	279	7	347	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002946_02126.