CAZyme Information: MGYG000002949_02765

Basic Information

• Species: UMGS1251 sp900549995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1251; UMGS1251 sp900549995
• CAZyme ID: MGYG000002949_02765
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000002949_39|CGC1	96124.22	4.8998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002949	4765419	MAG	United States	North America

• Gene Location: Start: 14020; End: 16458 Strand: -

Full Sequence      

MIQQNLCGRWKMRKAGEAMWQQASVPGTVYTDLLRNGQMEDPFFKDNEEKALELMEYDYE
YEASFYLEKEVSACKKKLLHFDGIDTIADIYVNERPAGSAFNMHRVWEYDVTDLLREGEN
TLRVLLHSPNRYIREEYQKCRTLGSEDALDGFVHIRKAHCMFGWDWGAHLPDAGIFRKVT
LTGIEKGRIESVYIRQIHEETKVKLQFQVETEMEEKNGERRYEVVITDPKGETRRYEDSP
ESIWIEEPMLWWPNGYGEQNLYHVKVILYCQEQMEDLWENRIGLRTMTVRREKDAWGECF
AHEVNGVKIFAMGADYIPEDHLIGRTSEEKTRKLLTDSRDANFNTIRVWGGGYYPEDWFF
DLCDELGLIVWQDFMFACAVYELTPEFKENIRQEFIDNVKRIRHHASLGLWCGNNEMEQF
VSEGHHWVTKHTEVRDYILMYEDLIPQVLKEYDPQTFYWPASPSSGGSFDNPNDPDRGDV
HYWEVWHGNKPFSEYRKYYFRYASEFGFQSFPCQKTIETFTDDEKDWNPFSYIMEKHQRN
YGANGKIMNYLQQTFLYPSDFNTFLYASQLLQGEAIRYGVEHFRRNRGRCMGAVYWQLND
CWPVISWSSIDYTGRWKALHYYAKRFFAPLLVSCQEEGMMTQEADMNREHFEFEKSIRLN
AANETREEAEVKISWQVRDAKARILHEETQTVQIPPLSAVWLEKKELPELRIRKEYVSFQ
MIRDEEIVSEGTVLFSYPKYFQYEDPKLSAAVLGDEIIVRSESYAKSVEILNEAEDIVLS
DNYFDMNAGEKRVKVLRGDTTGLKVRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000002949_02765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	734	1.3e-103	0.7353723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.76e-93	3	785	12	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.83e-14	4	416	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	1.19e-11	657	740	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	2.28e-08	745	810	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	5.55e-08	188	285	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	812	15	837
QIB54534.1	0.0	1	812	1	823
QMW79049.1	0.0	1	812	1	823
QQQ93614.1	0.0	1	812	1	823
ASU28856.1	0.0	1	812	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	5.96e-142	10	796	15	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.29e-142	10	796	17	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.46e-142	10	796	17	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.70e-141	10	796	15	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
5N6U_A	1.93e-140	6	769	29	776	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	2.82e-108	2	798	5	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1D911	2.25e-106	10	798	13	830	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
A2QYN2	4.29e-106	15	637	22	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	4.39e-106	10	798	13	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.66e-105	10	798	13	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002949_02765.