CAZyme Information: MGYG000002949_03773

Basic Information

• Species: UMGS1251 sp900549995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1251; UMGS1251 sp900549995
• CAZyme ID: MGYG000002949_03773
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002949_83|CGC1	26267.87	5.7816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002949	4765419	MAG	United States	North America

• Gene Location: Start: 10413; End: 11108 Strand: -

Full Sequence      

MKWIGRIIAWAFLFLVLAGGYFTYRGYQDYKEATENHVMQNQAEAVRNKEGYVPLADLPE
TYVNAVIAAEDKRFYKHPGIDILSIGRALFNDIRAGKMVEGGSTITQQLVKNLCFTQEKS
IDRKMAEIMMALQVEKDYSKDELLELYVNSIYFGNQFYGIGEASRGYFGVEPAQMTDSQS
TILAGIPNAPSAYAWNTHPELAKERQQKVLKSMVRQKYFTQQEADEIASQN

Enzyme Prediction     

No EC number prediction in MGYG000002949_03773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	214	2.8e-64	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.62e-83	43	214	6	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	5.52e-77	52	226	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.58e-72	52	226	78	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.53e-68	52	226	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	2.16e-52	48	229	52	236	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET89048.1	1.55e-78	4	230	7	233
QHB22227.1	4.78e-76	1	213	1	213
QEI32894.1	4.78e-76	1	213	1	213
QRT31378.1	4.78e-76	1	213	1	213
ADL05597.1	6.36e-76	17	230	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.79e-45	49	226	19	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.31e-44	49	226	19	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.59e-37	53	222	42	211	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	4.38e-36	53	225	43	215	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5ZZK_A	1.90e-35	46	230	53	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	4.93e-46	53	224	70	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87579	7.45e-42	52	226	70	244	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	2.61e-41	52	226	70	244	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	2.61e-41	52	226	70	244	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
Q5FAC7	2.61e-41	52	226	70	244	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.951265	0.037704	0.010170	0.000117	0.000070	0.000681

TMHMM  Annotations     

start	end
7	24