CAZyme Information: MGYG000002954_01016

Basic Information

• Species: UBA1191 sp900543485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; UBA1191; UBA1191 sp900543485
• CAZyme ID: MGYG000002954_01016
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000002954_10|CGC1	40281.78	4.3947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002954	2474898	MAG	United States	North America

• Gene Location: Start: 23506; End: 24636 Strand: -

Full Sequence      

MKRRILTTSFCILILCGAVLAALSITGTRQQLTLTEIINARRDPHIEALLDDMTLEEKAG
QMFMGCFYSGTPSPETVTQYNLGSVLLFQPSFTDSDKPSLKAALDDIDAACEITPIIAVD
EEGGTVNRVSSSPAFRSEPFKSPRQLFAQGGMDAVIADVHEKNALLSEIGIDLNLAPVCD
ISTDSDDFMYSRSIGLDAEATSEYAAKVVRACLADNMGCCLKHFPGYGNSKDTHKGAAVD
DRTIEQLEQSDLLPFAAGIKAGAPAVLVSHNIVSALDEALPASLSPAVHRLLRYDMGFDG
VIVTDDLSMGAVSSFSPTTSSAVTAILAGNDLLCTGDYASQYNVVIEAVKNGVISEERLD
ASVRRILSWKRDMSLI

Enzyme Prediction     

No EC number prediction in MGYG000002954_01016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	7.1e-45	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.92e-59	54	368	1	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	7.74e-52	53	375	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	5.85e-34	83	334	27	280	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.57e-16	152	375	132	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63470.1	1.33e-106	47	376	86	414
BCI61427.1	2.43e-106	43	376	150	482
QNM02560.1	4.98e-106	47	376	90	418
BCJ98858.1	2.67e-105	49	376	131	457
QWT55932.1	8.19e-105	40	376	102	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.40e-38	53	371	11	338	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.11e-33	17	370	10	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	7.24e-33	27	370	24	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	7.34e-32	49	370	12	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4ZM6_A	1.34e-30	51	370	5	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.07e-33	17	370	10	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
B4SRK3	1.73e-26	82	333	24	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	4.54e-26	82	333	24	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
D4AQ52	2.17e-25	55	374	21	352	Uncharacterized secreted glycosyl hydrolase ARB_06359 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06359 PE=1 SV=1
Q7WUL3	3.02e-25	46	375	19	354	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.563735	0.418443	0.014478	0.000759	0.000391	0.002176

TMHMM  Annotations     

start	end
5	27