CAZyme Information: MGYG000002956_00858

Basic Information

• Species: Lactobacillus kalixensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus kalixensis
• CAZyme ID: MGYG000002956_00858
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41594.27	9.7041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002956	1178622	MAG	United States	North America

• Gene Location: Start: 356; End: 1435 Strand: +

Full Sequence      

MIYIAVHLFADNCQDNTAKEMRKVMREHQYHGRQVKIIERTGSGGKAGVLNDALKIANGE
YIGVYDADAMPEKNALYFLVKKVLEKPDMYMASFGRNKTRNAEQNFLTRCINQEIVVTQR
IQHCGIWHLFKIGRIPGTNFIINTNYVKSIGGWRNGALTEDTDISFKIMGSGKLIALAYN
SEAFQQEPERLKDYYFQRLRWAKGNYEVVIKNFTHIFDHTNWRVKLETFYYSCTFFWFNA
AIILSDIFFISNLFALLLHIWNPAIVLPFTITSTNVLLAQVLLFNWLLMIMLHILQINTA
MATQYGQATTKQIWLALASYFTYSQLFIIVSVHAVSSVTLDRIFHRDGTKWVKTKRFSD

Enzyme Prediction     

No EC number prediction in MGYG000002956_00858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	202	2.2e-16	0.8304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	6.30e-36	6	161	29	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.32e-33	8	351	89	433	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	4.36e-21	4	296	87	356	N-glycosyltransferase; Provisional
cd06421	CESA_CelA_like	2.93e-17	13	208	39	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK14583	hmsR	2.27e-16	4	290	105	384	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAU31990.1	1.79e-214	4	359	80	435
QPB50940.1	1.79e-214	4	359	80	435
AFR21163.1	1.79e-214	4	359	80	435
AZK91866.1	1.79e-214	4	359	80	435
ASX14126.1	2.42e-212	4	359	80	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.38e-07	35	208	328	504	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	8.10e-45	11	358	88	415	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	3.41e-13	6	229	142	361	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q3MB01	1.06e-12	6	207	140	336	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.42e-12	6	207	140	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q8GLC5	2.19e-12	11	213	84	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
228	250
270	292
313	335