CAZyme Information: MGYG000002962_01883

Basic Information

• Species: Clostridium sp900543325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900543325
• CAZyme ID: MGYG000002962_01883
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000002962_43|CGC1	27525.79	4.5263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002962	3186188	MAG	China	Asia

• Gene Location: Start: 27672; End: 28403 Strand: +

Full Sequence      

MKKNIKYNGLGSYSKRNKKIKLEKICVVGIFTILILYIMALNLRSNISQEISSLQEVAAV
ENKEEESIVEESKEDSINQEVYSNTYMDSEKIDFIESISDGAISNYNKYGILPSITMAQA
ILESGWGNSELAVTHNNLFGIKADSRWNGAIATIVTSENYNDSTIANFRKYDSINESIED
HGKFLYENSRYAEYGLFDGKNYKEQAQALENAGYSTVKNENGEPIYADKLIALIEKYNLM
QYD

Enzyme Prediction     

No EC number prediction in MGYG000002962_01883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	102	239	4.9e-36	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.10e-51	85	243	37	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.75e-35	93	243	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	4.09e-32	110	236	171	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	4.95e-25	102	239	4	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	8.04e-24	93	243	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ68765.1	1.06e-64	87	243	61	217
CEK39773.1	1.09e-64	87	243	61	217
CEJ75314.1	2.19e-64	87	243	61	217
AUN13203.1	2.19e-64	87	243	61	217
QYE98430.1	6.22e-64	87	243	61	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.64e-21	94	243	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.14e-16	87	240	1	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.59e-16	87	240	1	151	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.20e-14	94	241	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.44e-14	94	241	5	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.76e-29	88	243	41	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	3.45e-15	94	240	163	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	6.99e-15	83	240	144	300	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9KQ15	3.85e-14	94	239	164	311	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P75942	4.49e-14	94	236	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999231	0.000496	0.000006	0.000002	0.000001	0.000284

TMHMM  Annotations     

start	end
25	43