CAZyme Information: MGYG000002962_02179

Basic Information

• Species: Clostridium sp900543325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900543325
• CAZyme ID: MGYG000002962_02179
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002962_56|CGC1	33619.66	4.1407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002962	3186188	MAG	China	Asia

• Gene Location: Start: 204; End: 1094 Strand: +

Full Sequence      

MKKFLIIISFMLLMIFGIISCGKNEENNKLMDTTNNEEQQIDNNNENLDQDNQEEDTEEE
SKVEEKEIEYINIAPEEVKIPILMYHSISDDDPNNNLLVPPSMFEEQMAWLEANEFTAMN
LDEALEAMETGKVPKRPVVITFDDGYSDNYTSAFPSLKNHGLKATFFVITDGVDNGYYMS
SDMLKEMQAAGMSIENHTANHLELDKLSRADAYDAIKRGQDFLRNNIGSDANYLCYPVGK
YSDETIEIQKELGIKAATTTQGGISSINDGLHKLKRVRIYPMSIESFASIFSEYIY

Enzyme Prediction     

No EC number prediction in MGYG000002962_02179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	131	260	4.5e-36	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	1.65e-56	137	281	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	4.44e-45	101	277	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.49e-39	131	257	2	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10973	CE4_DAC_u4_5s	9.33e-37	138	283	3	154	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	3.24e-36	80	257	1	183	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	5.68e-41	79	289	64	273
ADY56017.1	1.06e-39	79	287	85	293
AQS60291.1	1.55e-39	75	279	40	260
AEI34796.1	4.45e-34	74	279	25	232
AAK76800.1	4.45e-34	74	279	25	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	3.33e-37	78	281	7	217	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4HD5_A	7.37e-22	72	289	136	357	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
6GO1_A	7.29e-20	80	290	100	316	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
5BU6_A	3.98e-11	82	288	15	273	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
3VUS_A	7.60e-10	83	279	11	251	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	9.32e-44	79	281	64	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	9.87e-14	80	279	170	390	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
P75906	9.86e-09	83	279	52	292	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	9.86e-09	83	279	52	292	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
Q04729	1.00e-08	86	255	28	184	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000066	0.004930	0.994993	0.000005	0.000010	0.000006

TMHMM  Annotations     

start	end
4	21