CAZyme Information: MGYG000002963_00648

Basic Information

• Species: Anaerosporobacter mobilis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosporobacter; Anaerosporobacter mobilis
• CAZyme ID: MGYG000002963_00648
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002963_3|CGC1	47510.66	7.7655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002963	5077023	MAG	United States	North America

• Gene Location: Start: 142954; End: 144156 Strand: -

Full Sequence      

MRKVLQLVRSVVKKCIVLIYIILNKVLPLQKKTIVFGSNLGRNYSGNPKAIYENMVEQGL
DQIYHIVWFFENENTKIPGNAKIAKYGRFKYLYYMAVAKVWVFDCRQPKFLMKRKGVTYI
QTWHGTPLKKLALDMKEVTMAEGKDTDEYKKDFYNNAQTWDYLLSQNSYSTAIFRRAFAF
YKTMVEVGYPRNDILFTGNNEETIKELKMELGLPLDKKVILYAPTWRDDEFYCQGSYKFN
PSLAFHMFMEKLREEYVCIVKYHYLIQDSIDWADYKGFIYDYDKSYDIANLYLVSDMLIT
DYSSVMFDYSLLNRPMFFYAYDLEKYKDILRGFYFDFVSDVPGPISLKTEDLIDDILHYD
ANDYRAKYTRFHEKYNHLDDGHASEKVVEIIKSHISRNGE

Enzyme Prediction     

No EC number prediction in MGYG000002963_00648.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.93e-120	28	391	1	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	6.84e-88	8	393	3	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ10349.1	3.74e-123	29	391	345	703
QOV10415.1	4.05e-123	28	391	347	706
QYG90226.1	1.52e-121	27	391	365	725
ADP34069.1	1.52e-121	27	391	365	725
AMR61243.1	1.52e-121	27	391	365	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	5.02e-98	29	400	350	723	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	5.42e-97	29	400	350	723	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.50e-96	29	400	350	723	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	6.19e-112	27	391	377	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	2.49e-111	3	389	4	390	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	3.22e-97	29	395	350	718	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	6.35e-94	30	391	26	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKJ2	1.04e-31	25	391	251	603	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997046	0.002812	0.000102	0.000011	0.000006	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002963_00648.