CAZyme Information: MGYG000002963_02437

Basic Information

• Species: Anaerosporobacter mobilis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosporobacter; Anaerosporobacter mobilis
• CAZyme ID: MGYG000002963_02437
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000002963_15|CGC2	57251.44	4.9468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002963	5077023	MAG	United States	North America

• Gene Location: Start: 88590; End: 90131 Strand: -

Full Sequence      

MKRRVLSLLLTVTMVLTTITGVLRGISVSKTAHAEEVKYRNVGYYASWAGYARNYPITKV
DASKLTHLNFAFANLKNDGSVVVGDEWIDTQITSGVYADMGFNWEDAVVGMAGHFGALKK
IKARYPHLKTIISIGGWTWSNNFSDVAADPVKRAKMARTSVYFIVKYGFDGVDLDWEYPV
EGGNSIPHRAEDKHNYTLLVKEIREALDEQSKMDGKTYYLTIAAGGNPTFVQNTEPVELM
KYLDWINLMTYDYHGGFDPQTNHNTPLYLNPNDTTGSTFSIDQTVNAFLASGVEAKDLNL
GLGFYGRGWVNVNATPANCLFHNGIAASATSAGLDIGTWEGSSWDYWDIKENYIGKRGYV
RYWDDYAKVPYLYSPETKVFITYDDPESINIKIDYLLSKGLGGTMFWEASSDKNGDLLSI
TASRLGINEKEVIPPIDPETPVDPETPEKVGIYDNSKIYIAGDKVVYQGVIYQAKWWTQG
VAPDSNNEWGVWKVIEGTPETKTSVSQVNLIDL

Enzyme Prediction     

EC	3.2.1.14	3.2.1.17	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	38	416	2.7e-84	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	3.65e-144	41	412	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	8.26e-129	40	412	1	334	Glyco_18 domain.
COG3325	ChiA	8.70e-122	16	428	13	439	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	1.02e-98	40	412	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	2.46e-95	42	407	2	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66099.1	9.72e-153	36	437	45	436
AEY66103.1	1.88e-143	30	429	31	413
ACL75902.1	4.32e-139	20	429	18	409
QJC53462.1	7.62e-128	39	503	41	546
QKG84162.1	7.96e-127	35	419	234	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	5.81e-116	31	417	5	411	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	1.82e-113	39	425	7	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6BT9_A	4.88e-113	21	435	20	483	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KXM_A	1.03e-112	39	425	7	370	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	2.32e-111	39	425	7	370	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.77e-113	31	456	37	480	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	8.25e-76	39	415	39	393	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	5.24e-75	24	415	27	386	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
E9ERT9	8.85e-73	39	426	39	400	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
P32470	2.39e-72	39	431	38	402	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023693	0.948734	0.025829	0.000937	0.000416	0.000339

TMHMM  Annotations     

start	end
5	27