CAZyme Information: MGYG000002966_00055

Basic Information

• Species: Blautia_A sp900551075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551075
• CAZyme ID: MGYG000002966_00055
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000002966_1|CGC3	95135.09	4.5555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002966	4084328	MAG	United States	North America

• Gene Location: Start: 53312; End: 55753 Strand: -

Full Sequence      

MFEQNLTGIWKMRTVGMTEFLEAQVPGTVYTDLLRNGQMEDPFFKDNELKALKLLEEDYE
YAGVFDVNPKVWGSMHRILHFDGVDTLADIYLNGVHLGETCNMHRVWEYDVTDIVKEQSN
ELRVLLHSPLKYIAEAYKISKTHGTEDAMDGFVNIRKAHYMFGWDWGAHLPDAGLFRPIK
LLGIDEAGIDSVYITQNHSEGRVSLCLDVDMEEWEEAETERYIKVKIYAPDGALIVQTES
LDEIVIPNPRLWWPNGYGEQNLYEIEVVLYQGEKRLDTWKRRIGLRTMTMHREKDQWGES
FNLRVNGVDIFSMGADYIPEDHLLGRVTPETTRTLLEKGVWANYNSIRVWGGGYYPDDWF
YDMCDELGLVVWQDFMFACAVYDLTPEFEENIREEFIDNIKRLRHHASLGLWCGNNEMES
FVEERNEWVTKPQEVRDYILMYERIIPEVLAQYDPNTFYWPSSPSSGGSFDEPQDPNRGD
VHYWQVWHGNKPFTEYRKYYFRYLSEFGFQSFPAMKTIEEISDDPMDYNIFSYVMEKHQR
NGSANGKIMNYMQQTFRYPSGFPTVLYASQLLQAEGIRYGVEHFRRNRGRCMGAVYWQFN
DCWPVASWSSVDYCGRLKALHYYARRFFAPLMLSCEEEGLMTSGKDLNRQYFDFEKSIRL
NVANETREDQDVIVRWALRNSKAEILECKEEALHVPALTSVWMEKREFPDVDIYSEYVSY
ELECGGEIVSEGTVIFSYPKYFRYVNPNLSCRVTGDEIEIIADAYAKSVEILNDNEDLIL
SDNYFDMNAGSKRVKIESGDASSLRVRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000002966_00055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	691	1.7e-102	0.6835106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.10e-95	3	634	12	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.02e-15	4	417	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	7.69e-14	189	286	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	9.44e-11	58	423	66	423	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	5.72e-10	746	811	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	813	15	837
QIB54534.1	0.0	1	813	1	823
QMW79049.1	0.0	1	813	1	823
AWY97345.1	0.0	4	813	4	811
QQQ93614.1	0.0	1	813	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.45e-152	5	813	7	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.49e-152	5	813	7	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.06e-151	5	813	5	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.09e-151	5	813	7	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
5N6U_A	1.69e-142	5	770	28	776	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	3.32e-113	23	638	30	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	3.46e-112	25	638	32	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	1.38e-111	25	638	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.27e-111	25	638	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	1.03e-110	25	638	32	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002966_00055.