CAZyme Information: MGYG000002966_00153

Basic Information

• Species: Blautia_A sp900551075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551075
• CAZyme ID: MGYG000002966_00153
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002966_1|CGC5	36857.61	7.189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002966	4084328	MAG	United States	North America

• Gene Location: Start: 158005; End: 159006 Strand: -

Full Sequence      

MKLRHFAVFGGIFTVIISLLLFLFIVTADDEESSTSHFDFSGLNLSEEVLKHQPTVEKYA
KEYGISDYVNYLLAIMQVESGGTATDVMQSSESMGLPPNSLSTEESIKQGCKYFSELLKS
AEAKGCDIDTVVQAYNYGGGFIDYVAKHGKNYTFELAVSFAKDKSGGVKVTYKNEISIKE
NGGWRYKYGNMFYVRLVNQYLAVPSFSDATAQAIFKEALKYQGWKYVFGGSNPNTSFDCS
GLTSWCYGKAGISLPRTAQAQYDVTQHIPLSQAKAGDLVFFHSTYNSGTYVTHVGIYAGN
NRMYHAGDPIGYADLTSPYWQKHLIGAGRVKPK

Enzyme Prediction     

No EC number prediction in MGYG000002966_00153.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	5.56e-81	46	201	1	165	Lysozyme-like.
cd16891	CwlT-like	2.76e-77	52	202	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	2.89e-37	223	329	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	2.65e-35	207	330	362	481	invasion associated endopeptidase.
COG0791	Spr	9.31e-27	202	327	63	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL22199.1	2.17e-241	1	333	1	333
QIB54707.1	1.40e-219	1	333	1	334
QMW79222.1	1.40e-219	1	333	1	334
CBL37506.1	6.66e-218	1	331	1	332
ALU16411.1	1.10e-216	1	331	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	3.10e-165	30	331	5	307	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	8.11e-148	29	330	2	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	4.67e-16	211	330	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6BIQ_A	4.42e-13	223	319	167	267	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]
2K1G_A	9.26e-13	214	330	9	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	2.75e-76	39	331	47	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	1.23e-24	47	199	50	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P21171	1.44e-24	214	330	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	1.80e-24	214	330	412	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	3.25e-24	213	330	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.982509	0.016733	0.000503	0.000049	0.000033	0.000201

TMHMM  Annotations     

start	end
5	27