CAZyme Information: MGYG000002966_01761

Basic Information

• Species: Blautia_A sp900551075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551075
• CAZyme ID: MGYG000002966_01761
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000002966_15|CGC1	65692.14	5.0022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002966	4084328	MAG	United States	North America

• Gene Location: Start: 3814; End: 5589 Strand: -

Full Sequence      

MINMKEKPFYLTDEDCKWVEDTIAGMTLDEKIGQLFFNMGSSRDEDYLKMTVQKYHIGGI
RYNPASADEVYEQNRILQENSKVPLIIACNTENGGNGACTDGTMIGGQTKIAATGNPDYA
YNLGKMSNREAAAVGCNLSFAPVSDILYNWENPVIGLRSYGNDPEVVSTMVKAYMDGAHE
NPGFACAAKHFPGDGLDFRDQHVANSVNTFSCEEWDATYGKVYKTLIDNGLEAVMAGHIM
QPAYTRYYNPDIRDDDIMPATLSPELIEGLLRKKLNFNGMVLTDASHMVGLTCRMKRSDM
LPASIAAGVDMFLFFNDMEEDFNSMRKGYLDGVITDERLDDALHRILALKAHMGLHKKAR
TELVPPKERVHEVVGCKEHVDMQKEIADKAITLVKYKDQDVLPITPERYKRIMIVYVKGL
EAPGLGMLFSANKVSPAEKLRDKLKEKGFDAFIYESSIQKMMKQAQAGEKVDMNVYFAGK
SAISDFVSGQDLIITMVDIAGGFQPVARPSFGMTKGGGEIPWYVHELPVVVVGTQQPFVL
ADIPQARTYINTYDSADSTLDSLIKKLMQGKEAFTGKDPVDSFCGLMDTYI

Enzyme Prediction     

No EC number prediction in MGYG000002966_01761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	1.4e-47	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.51e-56	27	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	6.06e-56	26	407	1	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.37e-25	133	317	112	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.95e-17	19	404	38	407	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95878.1	0.0	1	590	1	594
ALC92197.1	5.21e-230	2	591	4	586
AVM68289.1	7.18e-227	1	590	1	583
QFK71386.1	8.00e-225	2	591	4	588
QPB43581.1	1.99e-222	2	591	3	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.29e-124	7	588	9	564	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	2.07e-50	26	553	42	581	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.07e-50	26	553	16	555	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.10e-49	26	553	46	585	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.09e-42	26	579	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.97e-129	1	591	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.14e-49	26	553	42	581	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q5QUZ5	2.68e-22	63	317	35	279	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
P44955	3.25e-20	63	319	35	283	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
Q31G32	8.57e-20	118	317	107	293	Beta-hexosaminidase OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002966_01761.