CAZyme Information: MGYG000002966_03510

Basic Information

• Species: Blautia_A sp900551075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551075
• CAZyme ID: MGYG000002966_03510
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000002966_62|CGC1	27700.82	6.1372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002966	4084328	MAG	United States	North America

• Gene Location: Start: 15546; End: 16274 Strand: +

Full Sequence      

MPMRRKRRKKHPVRKIFISLFSILLCLLLVTCAFFGIKGGQMYQKAVTEKSINERVKEIQ
DIDGFTPYSDLPQFYIDATISVEDHRFESHFGIDLIAIGRAALTDIKEMSFVQGGSTITQ
QLAKNMLFTQEKRLERKVAEVFAALELESQYTKEEIFELYANTVYFGNGNHGIYQASMAY
FGKEPSELTDYECAVLAGIPNAPSVYSQDEELTLQRVKQVLSSMVRNKIITQEEADRIEL
RD

Enzyme Prediction     

No EC number prediction in MGYG000002966_03510.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	65	225	1.1e-57	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.10e-74	66	225	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.23e-70	65	237	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.20e-65	67	237	80	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.57e-59	65	236	69	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.57e-40	69	236	72	241	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX26381.1	6.08e-90	14	239	5	231
ASB42272.1	2.15e-72	8	236	5	235
ANU54501.1	2.15e-72	8	236	5	235
QQR31552.1	2.15e-72	8	236	5	235
QNM09777.1	1.31e-71	23	236	23	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.84e-40	71	234	28	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.32e-40	71	234	28	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.09e-33	68	233	44	211	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	3.97e-33	69	236	46	215	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5ZZK_A	1.08e-29	48	234	43	236	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	3.19e-37	65	238	76	251	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O66874	2.37e-36	71	234	71	236	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9KNU5	3.95e-34	70	236	73	241	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
P38050	6.32e-34	69	207	73	211	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P31776	1.37e-33	22	236	5	230	Penicillin-binding protein 1A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.974530	0.001547	0.009189	0.000015	0.000008	0.014734

TMHMM  Annotations     

start	end
16	37