CAZyme Information: MGYG000002967_01409

Basic Information

• Species: Enterococcus_A pallens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A pallens
• CAZyme ID: MGYG000002967_01409
• CAZy Family: GH73
• CAZyme Description: Muramidase-2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000002967_8|CGC1	31020.72	5.6347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002967	2610517	MAG	United States	North America

• Gene Location: Start: 36857; End: 37717 Strand: +

Full Sequence      

MSQFKTRSERHTYEKQQRQKKMKKIMPVLGTALAVTPAVMGMNTVKAAAAETGQTQNQAA
FIEQLGASAMQVSASNDLYASIMVAQALVETGFGSSTLSAAPYYNLFGVKEYNGGPSVYM
NTQEYLNGQWVTMSEPFAVYSSYEESFLDHANIMRNSYYAGAWKSHTSSYQDAAVYLTGR
YATDPSYAGKLISLIQMYNLTRFDTPGAGTAVQTAAVTEQQTTQATAQPEAQAQVSTQAS
GQTYTVQNGDSLWAIAQHFGISVDQLLANNGLSMDSMLMPGQQLAV

Enzyme Prediction     

No EC number prediction in MGYG000002967_01409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	67	200	1.2e-28	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.74e-55	25	205	10	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.42e-51	36	286	132	374	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.04e-47	55	206	317	474	amidase domain-containing protein.
smart00047	LYZ2	4.88e-34	55	204	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.66e-19	66	200	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM18042.1	5.27e-132	1	286	1	290
QCQ13605.1	2.08e-130	1	286	1	285
AYQ23325.1	2.08e-130	1	286	1	285
QZO07791.1	2.66e-130	1	286	1	282
QXJ58041.1	1.08e-129	1	286	1	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	9.21e-35	58	204	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.44e-26	61	204	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.72e-16	60	195	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.10e-16	60	195	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.48e-15	60	195	4	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	2.86e-61	7	286	6	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P37710	2.87e-57	55	286	177	404	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	8.84e-54	55	286	59	286	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	3.44e-53	55	284	59	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	3.85e-52	55	286	59	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009194	0.989030	0.000698	0.000584	0.000260	0.000209

TMHMM  Annotations     

start	end
25	42