CAZyme Information: MGYG000002969_00701

Basic Information

• Species: Succiniclasticum sp900544275
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Succiniclasticum; Succiniclasticum sp900544275
• CAZyme ID: MGYG000002969_00701
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000002969_3|CGC1	59690.22	9.1585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002969	1973557	MAG	United States	North America

• Gene Location: Start: 131544; End: 133115 Strand: +

Full Sequence      

MKQLPRGAILLLLLVVGFMILFGIGGIPLLDPDEPVYAETAKEMIRFNDYLSPRIYNEYW
YDKPPIFYWLLVGSIKLFGGFSEFAARIPASLMAIGAVMLTAFSATRTFNAQAGFWSGMV
MGTTIMLMYMGKASVTDTSLLFFMTGALLCFMHQKYWLMYLFCGFAVMIKGPIGVVFPGA
IVFLYLLAARDLGRMTRMHVLPGLILVAAVGLPWYVYMYQNHGMSFIYEFIGFHNISRFA
APLHPKRVHWWFYLPVIILGMFPWTALLVKSIKDAFCKSVGEECNPLLFLQIWWLFVFLF
FSVAKTKQVSYMLVLAPPLSILMGWNIQRLFHHYKEECRGWAYGSGFLFLLMGLGWIFGG
RQLPELSRYGILLGVLTICLGIAVFFVLKFKKDPELAAWLHVGAGIVTMVMAFGFMMPLI
QDRFSVKTVAKTYVETYAKDASAGNAVLYIDKFLRPGFMLYTDIPGVEADTNSEKSLLDV
KQDHREKYIIMREFMYNKMKENMGGEDWELLENKSGICIYKSR

Enzyme Prediction     

No EC number prediction in MGYG000002969_00701.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	6	433	7.4e-106	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.09e-56	4	431	5	445	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.50e-29	6	418	6	429	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	4.04e-12	62	214	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.04e-06	12	221	2	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH48432.1	3.18e-245	2	521	5	524
ANR70824.1	1.05e-243	2	521	5	524
QNH53437.1	2.32e-240	2	521	5	524
AME03144.1	5.91e-236	2	521	5	524
AKT54119.1	8.38e-236	2	521	5	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.41e-31	29	330	54	367	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	8.16e-29	30	352	28	327	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
C5BDQ8	2.86e-26	31	355	29	356	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4ETL9	6.98e-26	7	323	10	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A4SQX1	1.63e-25	28	337	24	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A1JPM4	3.06e-25	1	357	1	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996312	0.002987	0.000271	0.000014	0.000012	0.000417

TMHMM  Annotations     

start	end
7	29
84	106
113	130
140	162
167	189
199	218
248	267
287	304
309	331
341	359
366	388
398	420