CAZyme Information: MGYG000002969_01812

Basic Information

• Species: Succiniclasticum sp900544275
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Succiniclasticum; Succiniclasticum sp900544275
• CAZyme ID: MGYG000002969_01812
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000002969_17|CGC1	57482.75	6.696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002969	1973557	MAG	United States	North America

• Gene Location: Start: 6119; End: 7675 Strand: -

Full Sequence      

MNRMSRNEFFLLLAAVVFAMFFSIGSFPLFDGSETFFAELAREMSGSDNYFVSQNFSAYP
LNLWPLGTWLTGTSFHLFGITEASARFPSAVMGAFTVLLTAVAVTRLFNERAGLCAGFIL
SSTVMLFYMGKTAAPETAFLFFLTGSLLAFLQEKYWLMYLCCGFSFLTKGPLGLLLPAVI
VFFYLLLLGDLRRLLKLHLFPGLILWLAVVLPWYIVLYETQGPVIGVYLLTVCRGWSEAV
TLPWTSGSLLDYPLVLLLGLFPWTGLALKAVKDGICESRMEDMRRLIFFQVWWITVLVFS
LLCPVRDAGSLLPLFPALAILLGWDLDRMLSEEEGHFSGWAWRNSLMYLAAAAGWIWATG
AVDEIAYVGVGLGALTLLFGIGIVVILAVYKDGSLGIGLQGLSGIVIMATAFSFLLPLTQ
DQLSIKSLTGEFGKKIKESGRVIYAESSLRPGVLFYTKEEASEVDFNSGNSLQKLAKDSR
PKYIFVRRQTYAKAAAFLDVSKWSLLAENGTYCLFEIK

Enzyme Prediction     

No EC number prediction in MGYG000002969_01812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	460	4.6e-70	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.07e-35	9	388	10	400	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	2.88e-12	65	213	4	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.63e-09	2	182	1	193	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1287	Stt3	6.04e-04	3	184	13	207	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	0.002	65	184	64	198	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77242.1	6.31e-106	1	493	1	493
QNH53437.1	4.58e-105	12	516	15	524
ANR70824.1	3.99e-103	12	516	15	524
AOH48432.1	1.12e-102	12	516	15	524
AKT54119.1	4.24e-99	12	516	15	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.40e-17	11	335	36	373	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	4.70e-20	7	321	3	316	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A0KGY4	1.61e-14	28	349	24	354	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
O67601	1.78e-14	4	328	1	309	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A4SQX1	1.16e-13	28	353	24	358	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
C6DAW3	3.48e-12	29	322	30	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.921319	0.071188	0.002151	0.000506	0.000306	0.004550

TMHMM  Annotations     

start	end
7	29
58	80
87	109
113	130
137	151
166	188
195	217
244	266
286	308
339	358
365	387
397	419