CAZyme Information: MGYG000002972_00346

Basic Information

• Species: Fannyhessea vaginae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Fannyhessea; Fannyhessea vaginae
• CAZyme ID: MGYG000002972_00346
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39539.05	6.4347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002972	1431879	MAG	United States	North America

• Gene Location: Start: 54046; End: 55092 Strand: +

Full Sequence      

MSDIALHGVNLSGWLKLEPWITPEYFAQAQVLDECAMVKSMSKQTYADLIQYHRSTFIGE
IDFKNIAARGFNAVRLCVPFYVFGDAGPFTSQFIGCADYVDQAFDWADEIGLKIVLVLDI
NPGNEGELSEHVPEFSSFNAYKNDALKTLSALAKRYAYRAALAGFELAAHPRIQKTFAFK
RQSGIPAHLLRNYYREGYEIIRSLAGDDVLVIMPDAHDPHMWRSFMASGNYKHTMLDIHL
DHFDEYFEMRGALTTQTLLAASKNYLHVAQKNGFKIMVGTWCSALPGLDSAMTPEGHIAQ
ERIYMSDQLDLYRGCDAWFFQTWKTQGRLSGWDARHAFSSFERRMICA

Enzyme Prediction     

No EC number prediction in MGYG000002972_00346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	323	5.1e-40	0.9536423841059603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	4.83e-12	2	336	14	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.64e-04	50	214	17	166	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPR41705.1	1.02e-258	1	348	1	348
SDR87855.1	1.96e-130	1	346	1	346
ADK68544.1	6.04e-127	1	346	1	346
AKT48931.1	1.56e-114	1	346	1	345
QOY61077.1	3.02e-112	1	346	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.08e-32	4	333	1	373	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.08e-32	4	333	1	373	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3N9K_A	6.70e-21	5	326	13	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	9.12e-21	5	326	13	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.19e-20	5	326	8	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XN12	1.36e-27	6	333	42	392	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	1.27e-26	6	333	42	392	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
D4AJL7	2.32e-26	2	340	30	396	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
A2RAR6	8.53e-26	6	333	42	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
A1D4Q5	1.61e-25	6	333	42	392	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002972_00346.