CAZyme Information: MGYG000002972_01125

Basic Information

• Species: Fannyhessea vaginae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Fannyhessea; Fannyhessea vaginae
• CAZyme ID: MGYG000002972_01125
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		72861.09	6.7986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002972	1431879	MAG	United States	North America

• Gene Location: Start: 1180; End: 3084 Strand: -

Full Sequence      

MQNCTLAHVIFENSQRFYQFPTLYCFSTASLQPVDMYQAKLLGDATYDFTSFMNACSVQK
WATYTYAQQFFLHVEFLGAPAKIQLTYAKAYDDHAQTYQTSYEIGGTTDEWQTQDIAYEL
DKDVVVCGFKITTTSDAMIRNCYYYTSVAPEHVCTPELALCTTTFKKESFIIKNAHMVRD
YILASSEPIAKHFSMHIVDNGRTLKASDVECAGIVLHPNPNAGGSGGYARGMIEAMRQEM
PATHVLLMDDDVSVCPESIMRTYAVLSLVRDTYRDAFISGAMMCLDAMDTRWEDVGHMTE
VGQCLSLKSPVSMAYFQNIVRNDLLCSHEEIKQIADNKHCYAGWWYCVIPASTIKRFGLP
LPLFVRFDDIEYSLRVRPKFISMNGIAVWHMGFNAKYNAAVERYQTTRNSFITQCTTHIA
SRHSLVARFRDLAFGLDLRKFNYADARLALEGFEDFLKGPRYIMKPGTVEERFMYAHKAA
EHLLPAEEFKAQLKDKLDFTLSNVYASSYVSSFENEYDISRSFKQKLIDLITFNGHRFTW
LAHSNPEPAIIDVAGWTYPSGVISQREKLLVINRFDGSGTIRTRDVHAFRELYHRFKRDM
KFYNDHKTQLERAYQEAMPEMTSVEFWKNYLGIK

Enzyme Prediction     

No EC number prediction in MGYG000002972_01125.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.20e-09	169	465	6	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	3.76e-07	180	377	17	157	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	7.78e-07	156	377	2	195	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPR41226.1	0.0	1	634	1	634
AKT48577.1	1.44e-172	1	633	9	642
BBH50617.1	4.73e-161	28	632	30	622
ATO39484.1	2.19e-158	1	633	1	623
AIA33500.1	8.33e-156	1	633	1	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	1.27e-23	44	463	71	492	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O53585	6.57e-23	44	463	51	472	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1
A0R628	1.19e-22	44	460	62	478	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002972_01125.