CAZyme Information: MGYG000002976_00406

Basic Information

• Species: TM7x sp900555425
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900555425
• CAZyme ID: MGYG000002976_00406
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000002976_20|CGC1	38084.03	9.8953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002976	624962	MAG	United States	North America

• Gene Location: Start: 14; End: 1027 Strand: +

Full Sequence      

MNRLAIIVLNWNGSDDAIECVDSLIKQTLKPTIIIVDNNSSDNSVTVFEEYISSHKKEKI
ILLKNSDNLGFAGGINTGLIYALKNNFEYIGVLNPDAIADKNWCEALVYQLSKYPECGIA
TGILQRRNSKTLDTTGDFYTTWGLPGPRSRDEPIKNAPTKPGEVFGATGGGAIYRAKIFD
DIDMFDEDFFMYYEDVDLSFRAQLAGWKVRFTPKAIAYHKVGASSKKVPGLAVYNTFKNL
PLVFIKNVPGKLFWHIGIRFLLTYWLIFASAIRHGNGWPAFKGALVSIIHKPAAYKKRFY
IQKNRKVSVDYIRNIIHDGPLPNQTGLLKFKHFFRIK

Enzyme Prediction     

No EC number prediction in MGYG000002976_00406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	182	2e-22	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	4.77e-56	1	292	2	287	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.22e-48	6	221	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	1.29e-22	5	230	1	214	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd00761	Glyco_tranf_GTA_type	5.50e-20	6	211	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.42e-19	6	179	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA06666.1	2.48e-201	1	337	1	337
QCT41847.1	2.48e-201	1	337	1	337
QJU05448.1	8.85e-188	1	337	1	337
QHU92537.1	1.26e-187	1	337	1	337
QJU10543.1	1.26e-187	1	337	1	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	4.63e-06	68	288	74	297	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P75905	8.54e-06	66	218	138	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	8.54e-06	66	218	138	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002976_00406.