CAZyme Information: MGYG000002981_00889

Basic Information

• Species: Collinsella aerofaciens_F
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_F
• CAZyme ID: MGYG000002981_00889
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		94403.4	5.0617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002981	2151937	MAG	United States	North America

• Gene Location: Start: 120945; End: 123416 Strand: -

Full Sequence      

MNKYNEQCPTNERQTMRVETTGVCRGNWKIYQQLKIEGIHEGSSIKAQAATVDDRRLPLS
LLKFKDNNGESDSYVLVIPDPDTRSIKVEFSEIGKDGRNLSSDSLSLNCKNIKWESRLNY
KIKPDMCSKLRNYDDVSEFEMATIDFWQCIEDSNEYILRCTVRTPYRNDSQIKLRCLDRF
LNEVELSIVNFGSNVTSVGFTSEKKQLETQLSIRMPKAFDRYYFIIGDQNHPSFSAFDCL
TPDKLGLLLEETNFLFTHAQFDPEYPEWFTEHKATIGALEKQRKIVFNSAPKFSIIVPLY
NTPISFFNDMVESVKNQSYANWELLLVNASPDNQELKARVEQETARDNRIKSINLTENKG
ISENTNAGVAVASGDFVSFFDHDDILEPDLLFSYAEAIENNNDVDLLYCDEDKLMPDGKL
AQPFFKPDFNIDLLRNNNYICHMLTIRKSLLDTLEPNTKEFDGAQDHNLTLRAVEKARKV
HHVAKVLYHWRLSETSTAANADSKPYATIAGIKAVQSHLDRLGLNAKVEQARRPFTYKVT
YAVPDSHPLVSIIIPTKDHADILNNCITSIVEKSTYDNYELVIIENNSTEKVTFDYYDKL
QAKYPDIVRLVTWEHEFNFSKLMNFGVAHAKGDYLLLLNNDTEVITPNWIETMLGICARE
DVGAVGAKLYYPDNTIQHAGLCVTGGVAGHLCQSMPRNNWGYFALNDAQQDFSAVTAACI
MTKRSEYEKVGGFTEELQVAFNDVDFCLKLREINDLIVYTPEVELYHYESISRGVENNTE
KQIRFHKEVAYMNYRWAKYYVEGDPYINPNFSVGEPGNRYYHL

Enzyme Prediction     

No EC number prediction in MGYG000002981_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	294	405	1.1e-20	0.6529411764705882
GT2	551	674	1.8e-20	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.87e-84	291	491	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.86e-36	552	769	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.08e-26	548	808	3	255	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
PRK10073	PRK10073	1.67e-19	288	428	3	139	putative glycosyl transferase; Provisional
pfam00535	Glycos_transf_2	1.67e-19	294	451	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69456.1	0.0	1	823	1	823
ATP53720.1	0.0	1	823	1	823
QOY61387.1	0.0	16	823	1	809
ACV56016.1	0.0	30	823	1	794
ACV56006.1	3.62e-206	16	823	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.34e-10	294	406	8	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.94e-128	268	813	344	890	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.70e-93	264	813	292	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	3.00e-13	291	533	4	252	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q58457	3.94e-13	291	492	8	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q57022	1.84e-08	291	464	4	177	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002981_00889.