CAZyme Information: MGYG000002983_00329

Basic Information

• Species: Gemella sp900555985
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sp900555985
• CAZyme ID: MGYG000002983_00329
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000002983_3|CGC1	54339.96	5.4727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002983	1248288	MAG	United States	North America

• Gene Location: Start: 16807; End: 18225 Strand: +

Full Sequence      

MKVLFVAAEAAPFVKVGGLGDVIGSLPKALQDENVEARVVLPLYSSIDREKYNLQYKQHI
FIDLGWRHIYCGIFETEVNGVKYYFIDNEHYFNRSSVYGQDDDGERFAFFSKAALEILPF
IDYKPDILNANDWHTALSIIYLDDFKSRGLDFYKDIKSVISIHNIEFQGRFNPYEMGNLF
GLDNKYFDALIYNGDLNLLKGAIQLSNRISTVSETYAHEILDPYFSYGLDSILKIEQGKL
HGIVNGLDIDKFNSETDKQIFKNFSINTLNDKVENKLKFQEELALEVNENIPMIGMVTRL
THQKGIDLVLHVADEILKTGAQLIILGTGDSHYEDALRALEYRRHDKVRSLIMFSSEMSS
KVYSACDMFLMPSKTEPCGLSQLISMRYATIPIVHRVGGLRDTVEPFDGKYGTGFTFESF
DAYDMLDAVYRATYCYYQERHNWNKLMKNTMKQDVSWKKSALKYINMYNEIV

Enzyme Prediction     

No EC number prediction in MGYG000002983_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	469	3e-169	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	468	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	0.0	1	468	1	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	1	472	1	464	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	471	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	9.18e-105	1	472	4	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS08181.1	0.0	1	472	1	472
QGS09312.1	0.0	1	472	1	472
SQH55555.1	0.0	1	472	1	472
QIX87763.1	0.0	1	472	1	472
VEI38824.1	2.14e-316	1	472	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	3.28e-86	1	472	10	498	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	1.55e-85	1	468	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.72e-85	1	468	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.12e-84	1	468	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	4.28e-83	2	468	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2TR28	4.02e-155	1	471	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
B2V049	3.25e-154	1	471	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
Q5FL65	1.70e-148	1	472	1	475	Glycogen synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=glgA PE=3 SV=1
Q97GX6	4.02e-147	1	472	1	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
C4Z0G2	4.15e-147	2	471	3	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002983_00329.