CAZyme Information: MGYG000002985_00108

Basic Information

• Species: Blautia_A sp900551715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551715
• CAZyme ID: MGYG000002985_00108
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000002985_2|CGC1	94987.12	5.9195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002985	2543992	MAG	United States	North America

• Gene Location: Start: 19383; End: 21836 Strand: -

Full Sequence      

MAKEVFEVTKDRFHLQDPCCYVLQGTWPKEAKMRACLDNSEVKAEIKRLEMVSALERFKD
PDLMRGERITATVQLPESLEGYHKLTVYADMSDKTIPWFSVPVKELEKRKGRPQFFIEEE
KVQQGFLRIRGWAIAAEPVKIQVFDEDKKKIQAEILRTERVDVEQLYEEYEEMGIHDKTG
FFAELTNLKGKILYVVFYAGDKKSVHIVHLNPAVVLQKKVQKYAEKGLRYWRNQGSRALV
DKMISKVKTASTREIPYQKWIIRHLPGNKELEKQRREKFDYQPKISIVVPLYKTPEKYLL
QLVESVKAQTYPNWELCLSDGSGENSPLTSFLKSLEAGDERIKVAYNEQALQISENTNAG
IEIATGAYIAFADHDDELTPHALFECVKALNKDRKIRLIYSDEDKMSMDGHKFFQPHFKP
DYNPDLLCTVNYICHLFVVQREILDQVGAFRKEFDGAQDYDFIFRCVEAVDPSEIYHVTK
ILYHWRCHEDSTAENPESKTYAFEAGKRAIEEHYHRTGIRAEVYQGEFLGLYRTRFLRDY
DPLISIIIPNKDHIEDLKRCMDSIDQKSSYKNYEYIIVENNSTDEKTFQYYKNLEEENPK
AHVVYWDKEFNYSAINNYGATFAKGEYILLLNNDTEIINETCLEELLGYCMRSDVGAVGA
RMYYEDDTIQHAGVVIGFGGIAGHCFVLQPRGTTGYCHRIICAQDYSAVTAACMLVKKSA
FDEVGGLTEELAVAFNDIDFCMKLREAGYLIVYNPYAELYHYESKSRGLEDTPEKVARFN
KEMQIFERRWPDILRNGDPYYNPNLTLKSQDFSLRRI

Enzyme Prediction     

No EC number prediction in MGYG000002985_00108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	286	396	1e-22	0.6647058823529411
GT2	545	668	4.9e-19	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.58e-100	283	487	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.29e-41	546	763	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.70e-27	542	768	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.56e-21	286	444	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	7.76e-18	545	721	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24563.1	0.0	1	817	1	814
CBL21587.1	0.0	1	817	1	815
QCU01344.1	0.0	1	817	1	815
QJU15224.1	0.0	1	817	1	816
ASU27525.1	0.0	1	817	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.96e-09	285	390	7	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	5.32e-09	283	376	5	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
1H7L_A	7.19e-06	283	453	1	181	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.30e-152	283	814	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.91e-97	257	816	293	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.90e-13	282	467	7	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71054	1.31e-09	283	504	5	223	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
A0A0H2UR96	2.96e-09	285	414	5	132	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002985_00108.