CAZyme Information: MGYG000002985_00109

Basic Information

• Species: Blautia_A sp900551715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551715
• CAZyme ID: MGYG000002985_00109
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	MGYG000002985_2|CGC1	93537.16	4.9863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002985	2543992	MAG	United States	North America

• Gene Location: Start: 21859; End: 24279 Strand: -

Full Sequence      

MEELCFSIDEERYDDRHGHILSLDGWYIHPEKRECGFVLLGDGYEKIDLPEIEHRERPDV
LTALNTDCGEVLPGFTVHIPEVLKLMEKFGDLELFLTEGDNRISIWSINAEDLHELVKES
LVEFHLDRIEVLYGTMLEIQGWAVDQRGSVEVTVHKEDTSLLDCRITRGRRPDVVERRSL
DDVYRSQEIGFRISAALPEIPGKKIILHFCGDSVTKTYDIDVESLRKEQKPKGFFYRLFH
KEPEKTDDYEQWILKHRPDKKTLRKQKKTVFQKKPLISIVVPLYQTPEPYLRELIDSVKA
QSYENWQLCLADGSPDDRLKGFLDRNYGKENRIVYRKLEQNGGISVNTNEAVMLATGEYL
MLCDHDDTLEPDALYEITKAINEKDAPDVLYTDEDKVSMDGKHYFDPNFKPDYNLFRLRE
NNYICHIFVVKKALTDRVGLLRTEFDGAQDYDFIFRCCEEADKVVHIPKVLYHWRCHMDS
TAADPESKAYAYQAGRRAIKEHYQRMGIDASVEMTERPGWYRSYVKIQDNPKISIIIPNK
DHIEDLELCLFSLTKRSTYKNYEILIVENNSEKPETFEYYKKLPDRYPKVKVLTWEKEFN
YSAINNFAAKQAEGVYLLFLNNDVEILTPQWIEEMLQICQQKDVAITGAKLYYPDDTIQH
AGVVLGLGGIAGHIMCKASREDPGYFGRTVTVQEISAVTAACMMIRTEDFWNAGGFDETF
QVAFNDIDLCMKVRAAGKKIVFTPYAELYHYESKSRGLEDTPEKQFRFDKEVKAFEAKWS
EQLAKGDPYYSPNLSVTEGDCSLRVD

Enzyme Prediction     

No EC number prediction in MGYG000002985_00109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	278	407	2.3e-23	0.7529411764705882
GT2	534	711	1.4e-20	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.53e-94	275	476	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.71e-42	535	752	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.39e-29	530	757	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.88e-24	278	481	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.27e-20	278	426	1	147	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	0.0	1	806	1	812
QCU01344.1	6.46e-229	1	804	1	813
CBL21587.1	9.14e-229	1	804	1	813
CBL36811.1	2.64e-227	122	804	1	713
CBK76130.1	2.64e-227	122	804	1	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	1.82e-07	275	401	5	128	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.72e-140	272	803	363	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.24e-105	242	804	286	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.46e-14	274	475	7	212	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q4UM29	4.33e-14	275	643	14	400	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q1RIM7	1.50e-13	275	683	13	437	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002985_00109.