CAZyme Information: MGYG000002986_00526

Basic Information

• Species: Gemella sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sanguinis
• CAZyme ID: MGYG000002986_00526
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002986_4|CGC1	40450.5	8.0796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002986	1827227	MAG	United States	North America

• Gene Location: Start: 26473; End: 27546 Strand: -

Full Sequence      

MIYYINALKTDDNTAGPKAPNDIYKLTKEYNGKEIIFNPFPVNKGRLYQKAWLLSKGVMQ
WMKVFSSAKEGDVVVYQHPTYGIGLNAKLIPLIQKHKKAKFIAVIHDLESLRMGVQKGVE
HNQELTDTADNKVLRCFNKIICHNDFMKKYLIEKGFEEDKLVSLEIFDYLTDAQMNNQVT
DGLAIAGNLSKGKSTYIYELLKTNPNYKLNLFGPNFDKSIELGGKIEYFGSFKPEVLPGE
LRGKFGLVWDGESLETCSGNTGNYLRYNNPHKTSLYLASGIPVIIWKEAAIARFIEENNA
GVVVGSLLEIENVLNNISEEEYAQIKKNAKEIGAKLREGYYYKKALEKCLAEDKVNE

Enzyme Prediction     

No EC number prediction in MGYG000002986_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	5	349	1.1e-107	0.984472049689441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	7.56e-90	3	348	4	328	sugar transferase.
cd03794	GT4_WbuB-like	1.38e-14	27	348	53	389	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	0.007	63	348	76	369	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS07606.1	9.91e-266	1	357	1	357
VFI12691.1	9.77e-135	1	349	1	348
APO15807.1	1.08e-134	1	349	4	351
CAI34313.1	1.08e-134	1	349	4	351
AQS23549.1	1.08e-134	1	349	4	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	9.68e-11	242	346	225	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	2.39e-09	64	346	60	322	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.47e-09	64	346	68	330	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	3.59e-51	2	355	1	329	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	8.98e-22	19	346	20	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	3.08e-18	19	346	20	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
A0A0H2UR93	4.30e-18	64	346	58	326	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
F8KEJ1	1.32e-16	19	346	25	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002986_00526.