CAZyme Information: MGYG000002986_00709

Basic Information

• Species: Gemella sanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sanguinis
• CAZyme ID: MGYG000002986_00709
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MGYG000002986_6|CGC1	72239.27	5.9758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002986	1827227	MAG	United States	North America

• Gene Location: Start: 53157; End: 55007 Strand: -

Full Sequence      

MNSMAEYLFHEGTNYNAYDFLGSFLVDNKCTFRVWAPNAKKVFITGDFCDWDARKYEMSA
INDKGLYEITIDNIKQFDSYKYVIISNYGQEIWKADPYAVHAETRPKTASKVYALPDYTW
NDGKWMNKRRVPYHEAMNIYEVHLGSWRYDENGNPLTYRQLVDELIPYVKEMSYTHIELL
PVTEYPYDKSWGYQATGYFAPTSRYGTPEDFMYFVDKCHQNNIGVILDWVPGHFTKDAHG
LYEFDGTCCYEYSDTRKMEHKGWGTRVFDYGRNEVMSFLTSSAVYWLEKYHIDGLRVDAV
SSMLFLNYCREEHESARNIHGGFENLEAIEFLKNLNLYVKENYPGVSMIAEESTSYPKVT
AGVDQGGLGFDFKWNMGWMNDSLDYIEVDPFFRKDSHNKFTFSMMYAFSENYILPISHDE
VVHGKKSLIDKNPVAYEDKFSSLKAFLGYMYAHPGKKLAFMGIDIAQFIEWDEERQLDWF
LLQYPKHAFTHRYVKELNKYYKNTAALWENDCNWHGFRWHVVDDNENNIFAFSRIDNSGK
EVLVICNFSGQSLHSYPIGVNTWGSYKIALNSDAKKYDGSALQNRNLKTVNKKTKDFEYT
LNVNIPAFTTMYIEKK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	167	467	9.1e-148	0.9966777408637874

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	2	616	8	628	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	32	614	42	620	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	7	606	609	1213	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	1	614	6	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	1	616	100	724	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS08178.1	0.0	1	616	1	616
SQH55558.1	0.0	1	616	1	616
QGS09309.1	0.0	1	616	2	617
QIX89041.1	0.0	4	616	1	613
VEI38827.1	0.0	2	616	3	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	1.31e-196	7	614	135	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.85e-196	7	614	135	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	2.62e-196	7	614	135	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	3.70e-196	7	614	135	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	3.70e-196	7	614	135	772	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	6.44e-222	6	614	11	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q8CZE8	1.87e-215	7	580	10	591	1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgB PE=3 SV=1
Q0SWZ1	3.45e-212	2	615	33	656	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=glgB1 PE=3 SV=1
Q5N4W5	6.01e-209	7	614	121	758	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) OX=269084 GN=glgB PE=3 SV=1
P16954	6.01e-209	7	614	121	758	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=glgB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002986_00709.