CAZyme Information: MGYG000002987_00365

Basic Information

• Species: TM7x sp900555265
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900555265
• CAZyme ID: MGYG000002987_00365
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31518.22	9.1695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002987	674133	MAG	United States	North America

• Gene Location: Start: 75157; End: 75975 Strand: +

Full Sequence      

MKNRIDIIIPYWGEFSLLKQAVDSVLEQTSDAWHLTILDDHYPDETAKNYYSKINDKRIT
YIRHCKNIGITNNFNYAIKHASAPFCVIMGCDDKLLPNYVETALKNINEADFYQPGVQVI
DAKSNVYLPLVDKIKRLLHPKKSCVLAGEKLATSLCHGNWLYFPSIVWRTSTLKKYSFDP
RYKILQDVIIELTMIIDGASLCFDSTETFQYRRFADSLSSKEKSKNGIRFNEEKEVYNDF
ANKFKSINWNKASFVAKTRITSRAHSLLSKLW

Enzyme Prediction     

No EC number prediction in MGYG000002987_00365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	168	5e-20	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	5.40e-20	6	167	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.63e-14	7	105	1	100	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	1.40e-12	4	130	2	134	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	1.40e-10	1	189	1	189	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	1.54e-10	11	146	7	143	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWQ31412.1	3.08e-176	1	270	1	270
QCT41836.1	7.55e-161	1	270	1	270
AJA06660.1	7.55e-161	1	270	1	270
QWQ32263.1	2.16e-160	1	270	1	270
QYF89691.1	8.42e-69	5	268	3	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q68X33	2.64e-08	5	187	10	186	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
P42092	3.69e-06	1	61	1	61	Protein CgeD OS=Bacillus subtilis (strain 168) OX=224308 GN=cgeD PE=4 SV=1
Q4UM29	7.67e-06	5	155	16	159	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002987_00365.