CAZyme Information: MGYG000002987_00698

Basic Information

• Species: TM7x sp900555265
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900555265
• CAZyme ID: MGYG000002987_00698
• CAZy Family: GT4
• CAZyme Description: Mannosylfructose-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		17571.36	7.7428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002987	674133	MAG	United States	North America

• Gene Location: Start: 67; End: 540 Strand: +

Full Sequence      

MRAAAKALDKCEKIVFVLFGNGEQRDELIELAANLGISDKMIFTGFVRGKQWRDIYCLID
VFVMSSVSEPFGLTALEAAHHDTALLISRQSGVGEVLNNIMRFDYWDVNKLADEIVNVAE
SPALQKSLKKNVKSEYARISWQDAARKCLKLYKGALA

Enzyme Prediction     

No EC number prediction in MGYG000002987_00698.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	2	127	5.8e-23	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	7.72e-24	2	153	212	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.81e-21	1	157	218	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	9.36e-17	2	153	221	370	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam00534	Glycos_transf_1	1.22e-16	2	133	22	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	1.63e-15	1	78	207	282	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWQ32695.1	4.28e-103	1	156	28	183
AJA06810.1	2.33e-101	1	157	244	400
QCT41484.1	3.48e-101	1	157	257	413
QJU07491.1	4.63e-81	1	155	243	397
QHU93798.1	4.63e-81	1	155	243	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BIS_A	5.65e-08	12	156	285	432	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3FRO_A	5.65e-08	12	156	284	431	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
3L01_A	6.48e-07	12	152	284	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
6KIH_A	8.93e-07	21	157	286	426	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
6N1X_A	2.88e-06	17	137	234	355	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	3.02e-17	1	156	227	385	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
A7TZT2	3.14e-09	26	93	302	369	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
A4FQ08	1.44e-08	1	155	252	418	D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=mshA PE=3 SV=1
Q9R9N1	1.78e-08	6	92	188	272	Lipopolysaccharide core biosynthesis glycosyltransferase LpsE OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsE PE=3 SV=1
Q65CC1	2.56e-08	1	123	224	349	2-deoxystreptamine glucosyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002987_00698.