CAZyme Information: MGYG000002990_01171

Basic Information

• Species: Allisonella histaminiformans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Allisonella; Allisonella histaminiformans
• CAZyme ID: MGYG000002990_01171
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37221.42	9.1874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002990	1615172	MAG	United States	North America

• Gene Location: Start: 134037; End: 135038 Strand: +

Full Sequence      

MAEKILIIKMSSLGDIIHAMPSLYMLRKHKPDAHITWAIHPAFAGILPGKPWVDEVYLVD
RKRIKQLSYLKQVRRDLKSRHFDLVIDLQMIAKSALISMLSGCSRRIGYWDAREGSWLIN
KPISGPHKHGHIIEQLLDVMRFLGCPETGIEFPFRDLTEPTQTLEKKLHDAGLHDPFVAL
VPGTRGENKKWPITMWGELAARLAERGIHSVISGAPSEKSMEEEILKRADSPYVIPLMGK
TSLLELAALEKAASVHVSSDTGPLHIANAMKTPIVALFGPTMPQRSGPYGNPYSTVLMAK
NPGHEDTDMSTISVDQVLEEVVKKWEQKNKPLA

Enzyme Prediction     

No EC number prediction in MGYG000002990_01171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	297	1.1e-52	0.8844444444444445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.44e-72	4	321	3	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.04e-65	4	321	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	5.18e-42	73	305	4	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	7.40e-32	3	281	6	291	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	4.35e-28	4	320	1	328	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH38976.1	2.31e-155	1	327	1	327
BBK25036.1	2.42e-139	3	317	7	316
BBU34623.1	5.73e-104	3	324	5	337
BBU36545.1	8.12e-104	3	317	5	327
CAB1276107.1	5.31e-102	3	317	5	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	8.47e-26	4	324	2	322	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	8.47e-26	4	324	2	322	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	9.62e-26	4	324	2	322	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	9.95e-23	3	289	9	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	7.05e-14	4	288	2	297	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.33e-24	3	291	9	294	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P26469	1.40e-23	4	290	2	291	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P25742	3.99e-23	14	281	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P24173	1.78e-21	4	290	2	291	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
Q9R9D5	1.15e-20	14	281	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002990_01171.