CAZyme Information: MGYG000002994_00128

Basic Information

• Species: Megasphaera sp002319965
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp002319965
• CAZyme ID: MGYG000002994_00128
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	MGYG000002994_1|CGC2	60948.26	9.1761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002994	2223689	MAG	United States	North America

• Gene Location: Start: 136598; End: 138208 Strand: +

Full Sequence      

MKQSSLLTLVFAATFLFLAAGISTLAVTDPVESNYALTALEMVRSGNWISPQIYGTYWYD
KPIFLYWLLSLSYSIFGATDFASRLPAVLFGAMSCTLAAWFALRQTGRTATALLFSAMTA
TSLVFWLISRSVITDQPLYFFSGATLFFAYIGVTEAKKNYMIAAYVMAAGAVLTKGPVGL
VLPGLFLLIFALVQRRTAYAKRLFPPVGIVLFLLLCLSWYGSMYSVHGKDFIDGFLGFNN
VTRATVSEHPEYDVWYYYLVLVPVSLLPWTGPCLYGLWKRRRHDDTYVFMAIWAVGTILF
YSLMATKYPTYAYIANWPLLYLGTWAIDSFHERDSHRLWLTVIIPTLLFGLLFASLTFFT
DKAPFPVDSLMMLTVFIAVMAALILIAWWQKAYIALPILITALTAVTYLMVTFQVLTPFY
QYRSAKNLITANISGQAYFFEEYRTSYPYYTGKTAIWTAPASYDENARLKRDEVWSKKHL
YPTEEEASVINRLENHQPLTIIVPKSRYRDYLASNFFPLTRETAQIGSYYIFTPAP

Enzyme Prediction     

No EC number prediction in MGYG000002994_00128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	458	1e-88	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.14e-43	1	408	5	423	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.77e-24	1	390	2	402	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.63e-14	60	219	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.90e-07	32	196	32	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	2.65e-05	55	303	56	347	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALG41393.1	2.16e-300	1	536	1	536
CCC72525.1	2.16e-300	1	536	1	536
AVO73980.1	2.16e-300	1	536	1	536
AVO26797.1	3.57e-299	1	536	1	536
AXL21032.1	1.26e-245	1	533	1	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.16e-27	30	334	57	371	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.16e-29	26	377	24	371	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q1CIH9	5.86e-26	4	350	9	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
A9R091	5.86e-26	4	350	9	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=arnT PE=3 SV=1
B2K5L1	5.86e-26	4	350	9	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q66A06	5.86e-26	4	350	9	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.488095	0.506763	0.001692	0.000733	0.000713	0.001999

TMHMM  Annotations     

start	end
5	27
54	76
81	103
107	129
136	153
168	190
203	225
255	277
286	305
309	331
338	360
370	389
394	416