CAZyme Information: MGYG000002995_01334

Basic Information

• Species: Enterocloster sp900555045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555045
• CAZyme ID: MGYG000002995_01334
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002995_26|CGC1	44056.38	5.0567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002995	4720348	MAG	United States	North America

• Gene Location: Start: 29104; End: 30240 Strand: -

Full Sequence      

MKILDRYIDQLLETSTPQAPIWNIEKIKEGKASTWNYIDGCMIKAVLELYHINKNPKYLE
FADRFIDYFVKEDGSIDSYDPKEYNLDNVNAGKTLFDLYELTGRSKYRLAMDTIYSQLKG
QPRTSTGNFWHKQIYPNQIWLDGLYMAQPFYMEYEVQNNDCKNCRDSYNQFLNVYRLMRD
PLNGLYYHGYDDSRKMFWCDKVTGLSDSFWLRAMGWYAMALIDTMEVMPEDMAEEKAQLN
RIYKELIHAMLPYQDEATGMWYQVVNRGGIAPNYLETSGSAIFAYAIMKSVRLGYLEPAC
FQRGMKAFQGICDTYLSEKDGKLQLDGICLVAGLGNLEKREGTFDYYMREPIVKNDAKGV
APLVLAYVETMFDRTPVR

Enzyme Prediction     

No EC number prediction in MGYG000002995_01334.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	370	1.3e-109	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.05e-90	35	369	34	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.52e-80	35	369	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91776.1	6.70e-233	1	376	1	376
ANU47524.1	1.57e-231	1	376	1	376
QQR03578.1	1.57e-231	1	376	1	376
QJU22745.1	1.83e-230	1	372	1	372
QRP36827.1	3.70e-230	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.98e-99	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.37e-64	32	369	36	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.42e-63	32	369	26	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.27e-09	170	311	197	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	7.53e-07	35	311	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.84e-63	32	369	36	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.79e-49	146	371	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.79e-49	146	371	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	7.76e-16	35	342	29	311	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002995_01334.