CAZyme Information: MGYG000002995_01709

Basic Information

• Species: Enterocloster sp900555045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555045
• CAZyme ID: MGYG000002995_01709
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		46548.25	4.3073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002995	4720348	MAG	United States	North America

• Gene Location: Start: 36535; End: 37785 Strand: -

Full Sequence      

MPNNSETGYRGLLQVNVVNIQNNFPIQNARVTISYKGDPESPLEQITTNSSGQTEQVALP
TPPLEYSLQPGDIQPYSEFNLRVEAEGFDPLVVSGTEILPDATAIQPVSMTPIGEVPPPE
DPIVIPDHTLYGEYPPKIAEDEIKPTSESGEIVLSRVVVPQTIVVHDGVPTDRTAKDYYV
PYRDYIKNVASSEIYSTWPRATITANVLAIMSFTLNRVYTEWYRNQGYDFTITSSTAFDH
KWIYGRNIFESISQVVDEIFDNYLSRPGVRQPILTQYCDGRRVQCPNWMTQWGSCDLGQR
GYSPIEILRYFYGDTIYVNTAEQIAGIPASWPGYDLTVGSSGAKVQQMQEQLDTIATVYS
AIPRVNPDGIFGPQTEAAVREFQSIFGLPQTGVVNFATWYRISHIYVGITRIAELV

Enzyme Prediction     

No EC number prediction in MGYG000002995_01709.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	6.47e-14	341	402	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	8.53e-09	297	402	1	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.18e-08	332	404	117	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92999.1	8.75e-267	1	416	1	416
ANU48790.1	1.24e-266	1	416	1	416
QQR02302.1	1.24e-266	1	416	1	416
ASN94441.1	3.40e-264	1	416	1	416
QRP40879.1	3.40e-264	1	416	1	416

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002995_01709.