CAZyme Information: MGYG000002995_03780

Basic Information

• Species: Enterocloster sp900555045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555045
• CAZyme ID: MGYG000002995_03780
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000002995_147|CGC1	52270.77	5.1459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002995	4720348	MAG	United States	North America

• Gene Location: Start: 673; End: 2073 Strand: +

Full Sequence      

MFYSDNRVTDVQIAYIGGGSRGWAWTFMTDLALEPSLGGTIRLYDIDENAARANEAIGNH
LSGRPEAVGKWRYETRKSLKEALDGADFVVISILPGTFDEMAVDVHMPERLGIYQSVGDT
AGPGGMMRALRTIPMFVEIAEAIKAYAPQAWVINYTNPMSLCVKTLYRVFPQIKAFGCCH
EVFGTQKVLKGIAEETLGIGEIDRRDVHVNVLGINHFTWFDYASYKGIDLFPVYRDYIEK
HFEEGYEEPDKNWANSTFDCAHRVKFDLFNRFGLIAAAGDRHLAEFMPGDEYLRDPETVA
GWKFGLTTVQWRKDDLKARLDKSHRLLTGQEEVKLEPTGEEGILLIKALCGLGQVVSNVN
ILNTGLQIPNLPAYSVVETNAVFDRNTIRPLVAGELPAPIRSLILPHVENHERILTAALT
CDRELVVEAFMADPQIIGKKCSEQDVRALVSDMLEGTRRYLPCGWF

Enzyme Prediction     

No EC number prediction in MGYG000002995_03780.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	13	190	9.6e-57	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	5.31e-172	11	454	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.27e-105	13	462	6	437	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	4.28e-76	11	462	2	428	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	3.02e-57	12	189	1	177	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	1.84e-47	11	455	1	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18468.1	4.20e-281	1	465	1	465
QOV18776.1	5.70e-279	1	465	1	465
QRP41858.1	1.73e-273	1	465	1	465
ASN93484.1	1.73e-273	1	465	1	465
QJU22170.1	2.64e-273	1	462	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.52e-159	11	455	6	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.64e-27	80	462	75	435	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	2.30e-27	4	462	1	438	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
7BR4_A	3.15e-20	11	449	13	462	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	3.27e-19	11	449	13	463	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	1.05e-254	1	465	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	1.93e-200	1	465	1	461	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	5.46e-185	1	465	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.03e-163	6	455	5	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	3.05e-50	12	462	3	429	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002995_03780.