CAZyme Information: MGYG000002996_00580

Basic Information

• Species: Desulfovibrio sp900546145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900546145
• CAZyme ID: MGYG000002996_00580
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000002996_4|CGC2	38875.16	7.3578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002996	2461669	MAG	United States	North America

• Gene Location: Start: 122848; End: 123930 Strand: +

Full Sequence      

MHFISSFGRNLAASLCAVQLCLCSGCTTQPGKASPAYTAPSSEDHVPLGEEGFGPSSGTP
APTSETDAGHSEANAPALLPCWQDLRSRLAADGLSGERVDALLATLGPLTQSPMGRKMKA
LYKKTFFPTPPPAHPQPAPTYYKGVVTQANAQKCRDFIARNQSAFSSAEKIYGVPSSVAV
SLLFVETRLGTVLGDVKENAFQTLASMAESRNVRDIPDWLHEMPGYEQHMDWFSQTMPKR
ADWAYKETRALVKYMLQSGLTPDRFPGSIYGAIGLCQFMPSNLPTYGADGNGDGVVDLFQ
VPDAVMSLSNYLSKHGWKPGVTRDKQYKCLLAYNHAAIYANTILALSDLVSGKTTPQPSI

Enzyme Prediction     

No EC number prediction in MGYG000002996_00580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	81	322	1e-44	0.6813559322033899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	2.62e-51	80	332	4	222	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	2.21e-30	141	323	92	247	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	8.38e-23	141	320	115	266	murein hydrolase B; Provisional
cd13399	Slt35-like	1.33e-22	267	348	24	107	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	0.009	155	349	61	251	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41794.1	1.06e-134	25	359	94	424
QCC86237.1	7.82e-133	32	357	79	401
AMD89133.1	3.95e-128	68	357	105	392
SFV73295.1	1.10e-127	9	351	6	363
ATD81641.1	8.58e-125	15	350	24	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LTM_A	2.02e-17	131	357	65	262	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.07e-17	131	357	67	264	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5O8X_A	5.06e-16	146	320	61	208	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	6.04e-16	146	320	78	225	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	1.03e-09	37	320	12	250	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.65e-16	131	357	106	303	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000026	1.000006	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002996_00580.