CAZyme Information: MGYG000002997_00022

Basic Information

• Species: Lactococcus_A piscium_C
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A piscium_C
• CAZyme ID: MGYG000002997_00022
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	MGYG000002997_1|CGC1	30314.65	8.0298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002997	1565244	MAG	United States	North America

• Gene Location: Start: 23416; End: 24204 Strand: +

Full Sequence      

MMCQHTFVICAYGKSPYLEACIQSCLNQTSVTSQASKIILYTSTPNTLIDALAKKYQLAV
FSNDGGGIGHDWNQALSFVTTKYATIAHQDDIYLPSYGTEVIKAFNHSDETNIVFTDYSE
NDAQDQLRPRNINLKIKHFGLSLMSLLQAKWYQKRIYALGNFISCPAVSYNMERLSDFKF
DEGLKMVVDWDAWERIMSLPGKVTYVKQRLMYHRIHNDSETTVNTLDKNRETEEFMMYQR
YWPTVIAKLLMRVYVKNQKGNQ

Enzyme Prediction     

No EC number prediction in MGYG000002997_00022.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	4.47e-10	8	116	2	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	1.83e-09	17	221	12	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	5.77e-07	6	130	1	128	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	6.33e-05	1	101	1	104	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04184	GT2_RfbC_Mx_like	0.007	16	117	15	120	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDJ25192.1	2.33e-191	2	262	1	261
CEN29387.1	5.49e-190	2	262	1	261
QDJ28872.1	1.09e-180	2	262	1	261
QIW57572.1	4.16e-132	4	262	2	260
QOG31422.1	5.33e-121	5	262	2	259

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002997_00022.