CAZyme Information: MGYG000002997_00223

Basic Information

• Species: Lactococcus_A piscium_C
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A piscium_C
• CAZyme ID: MGYG000002997_00223
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002997_2|CGC2	54163.21	4.9814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002997	1565244	MAG	United States	North America

• Gene Location: Start: 22524; End: 23948 Strand: -

Full Sequence      

MALRKDFLWGGAVAAHQLEGGWQAGGKGVSVADVMTVGANGVARRITDGVLPGENYPNHE
AIDFYHRYKADIALFAELGLTCFRTSIAWTRIFPKGDEKVPNEAGLQFYDDLFDECLKHG
IAPVITLSHFEMPYHLVTEYGGWRNRKVIDFFVHFAETVFRRYKDKVTYWMTFNEINNQA
NYVDDFAPFTNSGLKFEADEDREPVMYQAAHYELVASARAVKIGHEINPDFQIGSMIAMC
PIYPATMKPRDIMKAQVAMQRRYWFSDVHVRGHYPSYITAYFKRRGFTLDMTETDKQDLA
AGTVDYIGFSYYMSFAVKDTDNGAGFDYDEAKELIRNPYVEASDWGWQIDPLGLRYVMNW
FNERYELPLFIVENGFGAVDEVVDGKIQDTYRIAYLKAHIEQMKDAVEIDGVELIGYTPW
GFIDLVSAGTGEMKKRYGMIYVDKDNEGNGTLNRSKKASFDWYQQVIASNGEVL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	471	7.1e-150	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	474	6	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	474	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	473	6	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	474	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEN27630.1	0.0	1	474	1	474
QDJ28663.1	0.0	1	474	1	474
QDJ27034.1	0.0	1	474	1	474
ALS01743.1	1.73e-296	3	474	4	476
ALS36002.1	4.95e-296	3	474	4	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.46e-267	3	472	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.18e-267	3	472	7	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.39e-258	3	472	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	1.62e-229	2	471	10	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	1.02e-215	1	474	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	1.82e-225	5	474	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	5.58e-215	1	474	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	1.46e-188	5	474	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	2.47e-171	7	474	9	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P24240	1.27e-168	5	474	6	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002997_00223.