CAZyme Information: MGYG000002997_00662

Basic Information

• Species: Lactococcus_A piscium_C
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A piscium_C
• CAZyme ID: MGYG000002997_00662
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000002997_6|CGC2	41780.19	8.0578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002997	1565244	MAG	United States	North America

• Gene Location: Start: 43754; End: 44863 Strand: -

Full Sequence      

MSKFRLLKYFFIIVILVSYAGLVIFSISSNKEALQKDNYWDWYSSYVSQSTKGAFVNTGT
KEDPIALSESQGYGMLITVLAAQKGYIKEDQFMRLFHYYQANRISKNNTLMKWKQEKIKD
SWSSVDQNNATDGDLDIAYALIQAEKLWPNSFEHYGEAAHQIITSIKNYNYSGKTGLLTV
GNWATVDPKSETLIRSSDISPSYFKAFAAYTKDSFWTDLETNSVKALVEMSQQTETGLLP
DFAWVGSKGLTPVKPNEISGKNDGDYAYNAARVPYRLANSDDYQVKEVLDKMLGFLEKQP
VVYGGYTLKGKALVDNQSSSFSAPILYATKDDSNYSNLYASQRWIFNAPIKGKDYYGDTL
KTLVLLRLY

Enzyme Prediction     

No EC number prediction in MGYG000002997_00662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	366	5.6e-70	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.83e-20	42	366	11	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	4.31e-16	13	315	2	295	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	7.59e-13	40	356	28	340	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEN28757.1	8.12e-262	1	369	1	369
ATC61807.1	6.22e-211	1	369	1	369
QIW56350.1	8.83e-211	1	369	1	369
QIW57933.1	8.83e-211	1	369	1	369
QIW50943.1	1.13e-142	111	369	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.42e-40	40	366	66	400	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	3.20e-27	17	366	11	375	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	3.65e-27	17	366	17	381	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1KWF_A	5.21e-25	26	366	15	350	ChainA, Endoglucanase A [Acetivibrio thermocellus]
1CEM_A	1.35e-24	26	366	15	350	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.84e-39	40	366	66	400	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.81e-27	36	368	88	433	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	3.55e-24	26	366	47	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	3.36e-19	29	366	57	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P37699	1.64e-17	34	366	62	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995188	0.003551	0.000216	0.000025	0.000013	0.001026

TMHMM  Annotations     

start	end
7	29