CAZyme Information: MGYG000003000_01179

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_01179
• CAZy Family: CBM50
• CAZyme Description: Resuscitation-promoting factor Rpf

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172		16712.45	4.2193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 4106; End: 4624 Strand: -

Full Sequence      

MAGSPNGASREQQIQAAERLLAVQGWGAWPACSAKLGLYGKAGASATAQNYEAPAAQSQV
NTQAQAQESYTAPAAQAPATQAPAQQAPAAPAAAEAPAAQAPAAQAPAATYTAPAAPAAA
AGTYTVQAGDTLSGIAAAYGVQGGYNAIAAANPGTIVNVDLIYPGQVLNIPA

Enzyme Prediction     

No EC number prediction in MGYG000003000_01179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	124	171	2.6e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.17e-11	126	170	5	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK11198	PRK11198	8.07e-10	126	172	100	147	LysM domain/BON superfamily protein; Provisional
pfam01476	LysM	3.20e-09	126	171	3	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.30e-08	126	170	4	44	Lysin motif.
pfam06737	Transglycosylas	5.32e-08	2	32	45	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT89663.1	1.21e-80	1	172	73	244
BAV87480.1	1.21e-80	1	172	73	244
QXW92901.1	5.66e-79	1	172	73	244
VEI22518.1	5.66e-79	1	172	73	244
QXT29213.1	2.37e-39	1	172	72	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	9.02e-08	3	38	338	373	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
Q6M6W5	9.91e-08	8	75	87	150	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1
O86308	6.46e-07	3	171	85	221	Resuscitation-promoting factor Rpf OS=Micrococcus luteus OX=1270 GN=rpf PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003000_01179.