CAZyme Information: MGYG000003005_00528

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000003005_00528
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		35898.56	3.8979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003005	2620760	MAG	United States	North America

• Gene Location: Start: 16082; End: 17089 Strand: -

Full Sequence      

MPGWKWSDFNIPDGETASRVEVRISSDSTIGTWNGAFGTMTGDEWHQVDFNEYFNSNEAT
AVWNVAPDRAEMIDYKYGDLKIGFWWMTNDNYKIDSVTVYTNKTAEPETTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTP
TTTTTTTTTTTTMTTTTTTTTTTTTTTTTTTTTTNATTTTTTTTTTTTTTTTTTTTAATT
TTTTTVLPEDDIVWGDANCDNQVDMSDAVLIMQANSNPDKYGINGSDPSHISAQGLLNAD
VYDNGTSGVTNEDALKIQRFKLSFIASLDPKDSVQ

Enzyme Prediction     

No EC number prediction in MGYG000003005_00528.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM79	2	98	1.5e-23	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18522	DUF5620	2.31e-18	1	100	6	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
cd14256	Dockerin_I	5.94e-05	255	322	2	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EWM53237.1	1.30e-22	1	328	661	880
CDF00679.1	2.27e-21	1	105	162	271
ERJ89368.1	3.49e-18	1	102	91	198
CAC83072.1	1.87e-17	248	328	727	806
EWM54821.1	4.10e-17	253	330	574	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M2S_B	3.94e-23	253	328	27	101	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]
4V1L_A	1.62e-14	1	99	25	129	Highresolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_B High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_C High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
4D3L_A	5.78e-14	3	99	27	129	SeMetstructure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_B SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_C SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4V1K_A SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
5M2O_B	6.52e-09	255	325	29	90	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53317	1.83e-15	254	328	438	511	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003005_00528.