CAZyme Information: MGYG000003005_01610

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000003005_01610
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38547.2	3.9912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003005	2620760	MAG	United States	North America

• Gene Location: Start: 178; End: 1224 Strand: +

Full Sequence      

MEPSDYTIEVNSAPGGDFPENGWETVCTVEGNTLSSRQHLVNMEGYNWIRINISKADGEA
GKQASINFDIHNASDGVFDSWIFFGDSITAGGMNNCYGTGFATYVNRIDERYFPVQENGG
IGGITSTDGRNNIDRWLESYAGKYVSIAYGTNDAWGNQTGAERYYENTKYMIDAVLALGK
VPVLPKIPYAAESGVNTYLDEYNNEIDRLYEEYGDKLVKGPDFYGIIKENPDYLSGDGVH
PSSEGYEEMRRIWAETMYENVYKNDNIGEEICYGDVNIDGEVDMSDAVLIMQSLSNPDKY
GINGTDETHITMQGLKNGDVSGNGDGITNNDALAIQKYKLNLIDSLPE

Enzyme Prediction     

No EC number prediction in MGYG000003005_01610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	114	256	3.3e-20	0.7422680412371134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13472	Lipase_GDSL_2	3.22e-23	83	247	1	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	3.62e-20	79	255	2	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	9.26e-18	81	259	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
COG2755	TesA	2.45e-17	79	255	9	206	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd04501	SGNH_hydrolase_like_4	4.64e-16	82	249	4	175	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17359.1	4.56e-128	3	294	115	402
ADU20874.1	3.74e-118	2	302	563	860
ADL52279.1	4.14e-83	2	294	128	416
BAV13051.1	4.14e-83	2	294	128	416
BBH92959.1	5.95e-30	3	257	314	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M2S_B	8.40e-27	273	348	28	103	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]
5M2O_B	1.02e-12	274	347	29	94	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53317	3.42e-18	273	348	438	513	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
Q9RLB8	7.45e-11	136	296	136	312	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003005_01610.