CAZyme Information: MGYG000003008_00707

Basic Information

• Species: TM7x sp900555675
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900555675
• CAZyme ID: MGYG000003008_00707
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195		22574.65	9.5958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003008	664737	MAG	United States	North America

• Gene Location: Start: 798; End: 1385 Strand: -

Full Sequence      

MIEASKQWPSHKDEYQTQAKALLQDILKYNYNENTGILTVGNWVNKDSKYYNLMRASATV
PKQFQAFYEVTKDKKWLDINNKMLNSLETISSKTKTGLIPYFIWVDQSGACVVKPYTISN
QFDSTYSYNVCRLPYNLTQSNDEKSQKVLNKMLHFFMTQKNFFSSYNLSGKFLDDHQAAS
FKAPIAFATEKVKST

Enzyme Prediction     

No EC number prediction in MGYG000003008_00707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	2	191	8.1e-34	0.590625

CDD Domains     

MGYG000003008_00707 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC47941.1	9.33e-124	1	191	139	329
CCB93441.1	3.51e-109	1	191	139	329
SQF76038.1	3.51e-109	1	191	139	329
QEM32589.1	3.51e-109	1	191	139	329
AEJ53524.1	3.51e-109	1	191	139	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V5C_A	5.22e-10	1	189	144	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.29e-10	1	189	150	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29019	5.68e-09	1	194	200	402	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003008_00707.