CAZyme Information: MGYG000003009_00723

Basic Information

• Species: Oribacterium sinus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sinus
• CAZyme ID: MGYG000003009_00723
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000003009_151|CGC1	45504.91	5.3721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003009	1309457	MAG	United States	North America

• Gene Location: Start: 550; End: 1752 Strand: -

Full Sequence      

MGKKVKLGVIGLGQRGADLVKNVYSEHPDVDFIALCDVYKDRQEEVANALVEMGRERPKT
FSDYREMLSMEELDAVLICASWDTHSEIAMAAMRAGKAVASEVGGAYTLSECWKLVDCYE
ETKTPIMFMENCVYGRDEMMVYRMAEEGVLGEIVHCEGGYKHDLREEISFGKENRHYRLE
NYIHRNTENYPTHELGPIAKVLHINRGNRMLSLCSMASKAAGLREYIKEKKSEDKALQNT
VFQQGDVVNTIIKCSNGESILLTLDTTLPRAYSRGFTVQGTKGMYMEDNASIFLDGDEGA
KDHFEWKKQWGNVERFREKYEHPVWREYLKAGVKKGHGGMDYLIFSDFIRCLQEDLPMPI
DVYDMASWMSITALAEESIALGGQPVAIPDFTNGKWIKRT

Enzyme Prediction     

No EC number prediction in MGYG000003009_00723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	398	1.3e-149	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.25e-22	2	390	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.22e-15	5	123	1	113	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	9.45e-05	6	99	2	87	Predicted dinucleotide-utilizing enzyme [General function prediction only].
PRK13304	PRK13304	1.81e-04	5	99	2	88	aspartate dehydrogenase.
PRK10206	PRK10206	0.003	62	157	54	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	1.24e-188	1	399	1	398
QTH41319.1	4.29e-181	1	399	4	400
ALS29040.1	3.26e-180	1	399	1	398
QNK55026.1	2.11e-177	1	399	1	397
QJD87109.1	2.67e-173	1	397	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	8.38e-103	3	396	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	5.12e-72	4	396	42	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	4.36e-12	2	158	21	174	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E18_A	2.55e-10	3	157	4	150	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EZY_A	1.02e-08	5	152	3	144	Crystalstructure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	4.59e-102	3	396	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.58e-96	2	399	31	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	3.98e-94	4	399	49	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	4.22e-94	5	399	53	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	3.32e-82	5	399	43	435	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003009_00723.