CAZyme Information: MGYG000003010_01142

Basic Information

• Species: Granulicatella sp900551535
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Aerococcaceae; Granulicatella; Granulicatella sp900551535
• CAZyme ID: MGYG000003010_01142
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000003010_117|CGC1	38660.39	6.304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003010	1478056	MAG	United States	North America

• Gene Location: Start: 1240; End: 2256 Strand: -

Full Sequence      

MLVSVNISAYNEQDYLPEIFESLKNQTYPLKNIEVVLVNAMSTDNTRALMDQFKEENEHL
FYGVKILDNPRKTLNTGLNLGFKNSDGDCYLKVDAHSQIPTNFIEANVKVIESGQKVCGG
KRPTIVQAEDDFSKTLHIVEESALGSSIANYRKGDTSRYVDSVFQGMYHKDVVDTVGYFD
EKLTRTEDNEYHYRIRKNGFKIWYDTSIESFQYIRPTFTKMIQQKFANGYWIGLTSHVCR
DCLSLFHFGPGVFVATLLVLMMLTPISFAPLLTVFGLYLLAVLGLSIFEISKQKFNPTLL
LIPFIMIAIHFAYGIGTIKGWIFGFEFKKEYFDSEDKS

Enzyme Prediction     

No EC number prediction in MGYG000003010_01142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	170	1.2e-24	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.66e-91	2	254	1	249	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1215	BcsA	2.63e-19	3	331	56	381	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.18e-18	4	173	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.46e-16	1	295	3	286	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	4.24e-16	7	204	3	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS07417.1	9.99e-130	1	332	1	331
SQH54677.1	3.72e-122	1	332	1	331
VFH95114.1	1.52e-116	1	331	8	336
VTS73520.1	1.60e-116	2	331	9	336
VFH61913.1	8.71e-116	1	331	8	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	1.34e-11	3	104	15	110	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5MLZ_A	5.86e-09	1	122	23	139	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
5HEA_A	4.62e-06	2	105	6	103	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA59	1.99e-21	3	324	4	316	Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae OX=2188 GN=aglC PE=1 SV=1
P33691	3.80e-15	7	229	15	233	Succinoglycan biosynthesis protein ExoA OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoA PE=3 SV=1
D4GYH2	3.58e-13	3	229	9	224	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
B4ETL6	2.70e-08	3	151	10	159	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnC PE=3 SV=1
A0A0H2URH7	8.46e-08	3	142	7	139	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
243	262
266	288
301	323