CAZyme Information: MGYG000003012_01710

Basic Information

• Species: Blautia_A sp900540785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900540785
• CAZyme ID: MGYG000003012_01710
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		87212.29	4.1568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003012	3168635	MAG	United States	North America

• Gene Location: Start: 4112; End: 6415 Strand: +

Full Sequence      

MRKKIHKKISLLMAACMTAGMMGSVNVQAESLYTQEDFANVLDVTARLDETAYGYYETDK
FNIFSDMGAWHGYHLHTLDDVDTYGGFAGPHIIGQDVGMNLSDCISRLKLKKADGEEIDL
TDARTYTAYYPGKLMQYYEERDEYKVTLELIFASGRTNYVRTTIENYSDEPLVLDVAWDG
KVFDHNNIGDEAYPTNATFEDCENGVQVGFAEYSDAWTTTEETKYTIRHSEEVTTEIAED
KMSYVSRLNEPVTVEKGTPYVTYTAESYTFTSDEAAEEAKVVEGLFAEPEKAFEENRTRW
QGYLDKTFDKEDDVPKPYKNATVKAMETLITNWKSPAGKYKHSGLTPSMSYMWFNGVWGW
DTWKNAAGIAEFDPQLAADGIRCMFDYQIQEDDPVRPQDAGTIFDCFTYKEGSENFRNSK
PPLAAWGVWKVYQEGGDKEFLEEMYPKLTAYHDWWYTNRDTDHNGVAEYGGMVDDAHYQK
DEDGNILKDENGKPLLNVENIIEAAAWESGMDNATRFDQEGNGPDDVGVLVYENENAEGE
VVGYSLNQESVDLNAMLYAEKGFLKSMAEELGKTEDAAKYEEEAAELADYINTNMWDEET
GFYYDLQISEDGSEKKILTNRGKGTEGWMPLWAKLAPADRAEKVKDNMMDEEKFNLRVPM
PTASFDNDKFNPYRYWRGPVWLDQALYGVEALQNYGYEEEAKDLAYKLFDGAEGLLGDAA
IQENYNPVTGEGLHTKNFSWSAAAYYMLYKNALVETNPSTQTGLEMK

Enzyme Prediction     

No EC number prediction in MGYG000003012_01710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	10	752	2e-177	0.980701754385965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	8	751	2	782	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.52e-17	419	748	178	504	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	3.76e-09	439	742	186	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG3408	GDB1	8.69e-09	343	749	268	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	2.39e-08	419	644	203	430	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK81591.1	5.03e-302	7	767	4	769
AQM60257.1	1.44e-299	4	764	4	777
AIY84390.1	1.60e-299	4	764	4	777
QQP70135.1	5.10e-299	25	765	45	797
AIF42982.1	6.73e-298	36	765	53	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.90e-144	53	751	21	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.16e-143	53	751	21	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.04e-143	53	751	21	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.91e-137	36	751	4	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	3.34e-57	484	751	9	304	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	4.08e-143	53	751	44	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.57e-13	358	743	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.08e-13	358	743	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P49381	3.47e-08	354	747	306	717	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
P94250	1.76e-07	387	707	83	330	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003444	0.989417	0.005709	0.000577	0.000425	0.000409

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003012_01710.