CAZyme Information: MGYG000003016_00742

Basic Information

• Species: Salinicola tamaricis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Halomonadaceae; Salinicola; Salinicola tamaricis
• CAZyme ID: MGYG000003016_00742
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2485	MGYG000003016_17|CGC1	260414.79	3.8716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003016	3944563	MAG	China	Asia

• Gene Location: Start: 4861; End: 12318 Strand: +

Full Sequence      

MFSLAIVDAQTGTLVRTLTPGDALTRDLIGDGYRLQVTPLDGADFSASQVRGVVVTLDDA
GGSQQQHSTFITPFRVALDENTGRGGALLKIEAVNGAGTTILGSAQTQALEIVNHEGWSS
DVYTLQGTSLIADDGSSLADTGVRDADHRESSPTAGSDGLWNGHSGSGYLDMGSQVGDAA
YFDVTVESAGTYQLDVRYAASGSATTSRPMAVKVDGEAQGVLGFTGTGNGSAGWETWNHA
TLTLALEAGSHRIRMENLLAEGPNVDSLALSLVKAAVGMPPSFTLQAEDTSRVEIHDLGA
SKDPSLTRVVDATHPDAGGSHRAGAIGDSYVDLGTNPGDSVIFHAEPSVEGLYTATIRYA
NGGSGDRPLLLNLDNGAAMLVSFPPTGGWASWREVQVTLPLSAGSNALTLSLPSAAEGGV
PNGPNIDQIAFDYAGEMTAPPTLVASIEGETMGHDDGNSPADTVVRDASHPESDPAAGSD
GLWGDYSGSGYLDMGEQAGDAATFQVSVVQAGTYELVVRYANGASDTQEMKVVVAGESQG
KVAFGSTGDGASGWENWTEVRYAVTLAAGNNAIRLENIGAGGPNIDKLEVHHVVDAVVEP
GERPVIKINFQPANAATPEGYVADTGLAFGAQSLQVDGKTHAYGWVTEASIADGTANGTT
PMGISGQDPDALGNRAGTLAGVDGLQATYAGFAKPGYAQHAGWEIALEDGYYEVTLSLGD
SGGQYDSVNVINAEGEAFGRLVPMRPDGFPADANPADDSQGYRSTLITKVVHVTDGRLTL
DSIGADSANTEIQYLEIQPLPDLTPDDDRAAPLDYAHFTDPRAVAGVGQNQVEVDLQPSD
GSPPVGIDPTSDIFIGISVVEGRGGALLESLQDGSVRLFNTVTGEAVAFNINTTGGFDSL
TISPVDGLDPYTSYTLVIDGFQDRGSNTDTAAPTRDFQKFTTTFVTGAEAEVPDSEVAFN
STVELNGAEDNAYQFTSMTLSPDNSKLYVSTMNGEIRRFDIDPITGALSHEQTLALDYFQ
DDAGARGIIGLTFDPTDPDVIWVTDNYPIPLTGRDNGVPDFSGRVSKITLDHDDTVFSGS
AQTYITGLPRSNGDHVTNSLVFHANPDYDALTNPDVPPYLMYVSQGANTAMGQDDSAWGN
RPERLLNAAVLEIDPYREAPPGGFDVSTEPLPSDGSNTRYPDSDGDLKNGPIDMGGGQYL
VFAADGTASMQDADGNLLIQYYDPYAADAVLKIYATGIRNAYDLVWHSNGSLYLPTNGSA
AGGSTPDDPATTVNEGLINVGIEDDFLFQIEKGGYYGHPNPLHDEYLLNGGNPTSGKDLN
ETDEYPVGTQPDPNYRGEDAYSLGTNRSPNGAIEYTSGVFGATLKGSLLFVEYSGGDDIR
WITLDADGKVSGDSVLRDPDGKVISFVDPLDIIQNPLTGQLYLMTLNRTNGQSQIIRLDP
VPGDVVVPGDDLKSVATIQAEDDTLATIASGAGVQIVIRDGDNPEPASANVGTASGVRPG
AYGLDGNTDDSDGVVGGYADFGSTNNDFITFDVDVATGDAGAAVLRVRYANGGTGERPLE
VFVNGESVGTYGFAPPTGMGSGNAAWNTWQTLDIPATLLAGANSVTLRSVNNTGPNIDQL
EVLVHDTTPGYTLYEAESATLEGGAVVVPPTVSDRDASGDGYVDFVGSGDQTLSWQVEVA
RSGVYEIGFRYSLTTGKADRPLALEVNGSDYPAVNFPAKSATVNDWVYQTVQVTLTAGIN
TIAVTAPNANGPDIDLLQVPDVPLSVAADGKISAVSADPAFFSDRLAFNYLENNHASGSA
PEAREYKDSGTVIVTNQGSGDLTLTGATLDGPFRLSDPDALEGRVLAPGAALSVEVLFDR
AAYTPPSSNADDGVFQGSLTIHSNDADTPTTQIQLAGFWQARDEGGWEPNLNEIWRVFGF
GNHIDGLSTLDGGGESVLQDFDLYRAVNDEEVLSRYWQLADGVQSAKVTQLAALHGYSGA
LLALHAPGDKGERTSLMNHDSLYSQSFLPHVANGNYATATFDRGRIPDSWAGDDVFGISV
ANLSTDPSLNPHGGGTPPAEDASIERGYTVRVFQAYDSEHNAIPDTYFVVMDYTGINYDY
NDNVYLIQGIQPALRSPFNDTQTPWAVDADGLTLDAALFDEGPAHLTYKDSSETQLGNPG
FRDTGVDIQGNGDAIGWIEEGEWVEYTLEVDTAGVYDLSFLSAMGAQSGTARSISATFDQ
GSGVYAVADVGVGYSGGWNTFLPTQGHQVMLEAGEQTLRLTFHGGAMNLASFTLTPASQS
AFNADGTPWTVDSEFTLQAALYDQGGEGVAYHDSSETQLGTNFRDEGVDIRGNGEAIGWI
DNGEWVEYTLDVAEAGSYQLSFAAATTAGGRSVTASVAQAGQVYDSATSASVINTGGWNN
YQSNEGVTLDLTAGEQVLRLTFNGGAMNLANFTLTATAGSSESGSSAPSASDATLATSDS
FDSEPAMSDDVAISGVDTPQHVEIA

Enzyme Prediction     

No EC number prediction in MGYG000003016_00742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	2301	2435	7.6e-27	0.9710144927536232
CBM35	485	590	2.3e-22	0.8403361344537815
CBM35	1634	1757	9.1e-21	0.9747899159663865
CBM6	2139	2275	1.1e-17	0.9637681159420289
CBM35	163	269	1.9e-17	0.8319327731092437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	1.88e-38	2296	2435	4	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
271146	cd04080	4.40e-24	2133	2275	4	144	CBM6_cellulase-like Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04082	CBM35_pectate_lyase-like	1.17e-23	486	590	22	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04082	CBM35_pectate_lyase-like	6.43e-22	1517	1622	26	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04082	CBM35_pectate_lyase-like	3.10e-21	163	270	21	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEP38104.1	0.0	285	2434	1346	4009
QKS26400.1	0.0	285	2434	1087	3911
ALM52865.1	0.0	102	2476	1574	4726
SNY98263.1	0.0	127	2434	1604	4524
SBR45367.1	0.0	127	2434	1604	4524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7O_A	1.22e-22	189	590	750	1097	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]
2VZP_A	7.43e-16	486	588	25	125	AtomicResolution Structure of the C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZP_B Atomic Resolution Structure of the C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZQ_A C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with digalacturonic acid [Amycolatopsis orientalis],2VZQ_B C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with digalacturonic acid [Amycolatopsis orientalis],2VZR_A C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with glucuronic acid [Amycolatopsis orientalis],2VZR_B C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with glucuronic acid [Amycolatopsis orientalis]
2VZT_A	2.73e-13	486	588	930	1030	Complexof Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZO_A	2.73e-13	486	588	930	1030	Crystalstructure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZU_A	2.73e-13	486	588	930	1030	Complexof Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56F26	1.50e-12	486	588	930	1030	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
P70873	2.16e-09	163	590	433	862	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P23030	3.30e-08	1517	1623	189	289	Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynB PE=1 SV=2
P23031	3.38e-08	1517	1623	189	289	Alpha-L-arabinofuranosidase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996983	0.003007	0.000033	0.000006	0.000003	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003016_00742.