CAZyme Information: MGYG000003016_03062

Basic Information

• Species: Salinicola tamaricis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Halomonadaceae; Salinicola; Salinicola tamaricis
• CAZyme ID: MGYG000003016_03062
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	MGYG000003016_156|CGC1	25133.82	9.2979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003016	3944563	MAG	China	Asia

• Gene Location: Start: 7315; End: 8004 Strand: -

Full Sequence      

MRSSPSAWADHHLTGRALAGPLAVLLLATGSLPAAAAQAAASPPTQLAAPAAVIGPADMP
PDPALIQALAQAMAAEPDSGDHFDAQVWLLDMQSRLARRHLTAYPDRQARLRLLQRVYVE
ARRVALPPALVLALIDVESRFHPAARSSVGARGLMQVMPFWKAEIGRPQDDLEDVATNLR
YGCTILAHYLSRENGDWTRALARYNGSLGRTTYPEQVMAAWYHYWWVKR

Enzyme Prediction     

No EC number prediction in MGYG000003016_03062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	120	219	3e-22	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.30e-27	128	210	1	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.22e-26	126	210	17	108	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.67e-22	121	221	14	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	5.99e-21	121	211	5	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.01e-16	121	206	147	239	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCK75614.1	5.84e-59	62	227	35	196
ABC31468.1	1.51e-58	49	228	30	205
AJE16069.1	3.56e-58	61	228	26	189
QIJ00303.1	3.56e-58	61	228	26	189
QQN50582.1	3.56e-58	61	228	26	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	8.10e-07	121	210	424	517	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	8.12e-07	121	210	428	521	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	8.14e-07	121	210	434	527	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	8.16e-07	121	210	438	531	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.18e-07	121	210	444	537	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	1.57e-07	121	209	1430	1516	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.57e-07	121	209	1430	1516	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002663	0.995204	0.000571	0.000981	0.000313	0.000240

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003016_03062.