CAZyme Information: MGYG000003016_03165

Basic Information

• Species: Salinicola tamaricis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Halomonadaceae; Salinicola; Salinicola tamaricis
• CAZyme ID: MGYG000003016_03165
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664		73746.01	6.4465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003016	3944563	MAG	China	Asia

• Gene Location: Start: 4849; End: 6843 Strand: +

Full Sequence      

MREFPMPAFLQRSLGKRQPWLRRCFAGALGLALAAPALAATSSDDLVMKQALDAARDQRW
DAIDQAAIQDHVLAGYVEYHRLRARLSTASAAEVNDFITRYGDSPLAGWMRGTAQTRFGQ
LGRFADLLAISDGEPDGAIRQCYYYTALLDRDPARAAAGGEKLWHVGASQPDACDTLFAT
LTQRGVLTDEDTWERMMLAWENGQSGLVSYLERNLGDAWQPAITQFERLSANYAAVTQIP
QDLGPGKGAAGALTAATMHAFTRADTEAALEAWRKIAPHAALSDAQRERVEHDLAFYSMV
RDVANNQGWVDANLPRLADADLIELRIRNAVTAGHWQNVVRWTQALPAEARGDAHWQYWL
GRAQAALGNDEAARRAYANAASERSFFGFAAADRLGQPYHLQMSDTRVTTLQQELANMLP
VVQRTEALMRIGEEGLARSEWYTAAARDTPEQAAALADYAIRQGWYAMAVQTTIAAKQWD
ALPWRFPAAYRESFLHWGERQQVDPFLLMGIARRESAFNPEAMSPVGARGLMQLMPGTAD
HVARQLGIAAPSSSELFQPQTNIRLGSSYIRSMLERYRGNRIAATAAYNAGPQRVDRWLT
SAPQEFDRFVESIPFRETRDYVQAVLAYRVIFESLAKQGDTQGVAMLTPAERQGRYDPTL
IARN

Enzyme Prediction     

No EC number prediction in MGYG000003016_03165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	499	629	5.1e-31	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	1.39e-123	52	656	30	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.25e-73	485	635	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.58e-52	487	629	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.16e-37	505	628	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.71e-36	355	635	2	286	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABE59846.1	1.44e-296	17	664	7	660
CBV43312.2	3.69e-279	40	664	24	648
APX93825.1	2.06e-276	31	664	17	649
QFT85959.1	3.80e-272	17	663	7	649
QJQ95329.1	5.01e-272	43	664	27	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	3.13e-84	48	628	13	594	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	8.86e-83	48	628	13	594	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	2.08e-81	65	632	24	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.33e-81	65	632	53	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	6.06e-81	65	632	24	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	3.22e-83	48	628	40	621	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.22e-83	48	628	40	621	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	8.76e-83	48	656	40	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	1.06e-47	294	642	238	582	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	3.23e-18	499	625	69	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005207	0.993398	0.000487	0.000434	0.000241	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003016_03165.