CAZyme Information: MGYG000003016_03198

Basic Information

• Species: Salinicola tamaricis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Halomonadaceae; Salinicola; Salinicola tamaricis
• CAZyme ID: MGYG000003016_03198
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000003016_175|CGC1	37903.69	6.2795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003016	3944563	MAG	China	Asia

• Gene Location: Start: 4598; End: 5638 Strand: +

Full Sequence      

MALRWKQGSLTRALALVVVLVGGLSSAGTALAETDFDPATHPEVRAMLDTLSAQGLSSQQ
LDDAMRAASYRPQVLEAMNHAAERRLRWDQYRDIFIQPDRVAQGVAFLQQHREALDRAQR
EYGVPPEVIVAILGVETRYGAHKGSHRVLDSLSTLAFHHPTRGDFFRRELMAFLTITLGQ
GVDPASRYGSYAGAMGYPQFIPTSYQAYAVDFDGDGLRDLWNDPTDAIGSIGNYFSEHGW
RRGQAVLVEASGPATPPAQFAFNQTEPPSTRVSELAAAGIRPTAGSLAPGDKVMPLALDY
ADGHVRYVLGLDNFYVITRYNHSHLYAMAVATLAQRIQLALEATET

Enzyme Prediction     

No EC number prediction in MGYG000003016_03198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	47	337	3e-103	0.9694915254237289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	9.12e-130	41	335	3	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02282	MltB	9.86e-118	45	337	1	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	1.34e-103	37	340	53	356	murein hydrolase B; Provisional
COG2951	MltB	1.61e-99	6	340	2	338	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02283	MltB_2	2.30e-75	53	337	15	298	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABE58900.1	5.20e-139	28	342	27	340
QHD49583.1	7.23e-136	17	343	13	338
BCB69919.1	4.50e-132	17	343	13	338
BCA91634.1	4.50e-132	17	343	13	338
QEA40975.1	5.31e-132	14	346	7	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ANR_A	1.24e-82	38	340	19	319	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5O8X_A	1.45e-82	35	340	1	302	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
1LTM_A	3.34e-73	37	340	12	317	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	3.55e-73	37	340	14	319	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	6.26e-41	53	334	61	340	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	6.10e-72	37	340	53	358	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998982	0.000211	0.000178	0.000155	0.000137

TMHMM  Annotations     

start	end
13	32