CAZyme Information: MGYG000003017_01607

Basic Information

• Species: Duodenibacillus sp900538905
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus sp900538905
• CAZyme ID: MGYG000003017_01607
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000003017_36|CGC1	43025.17	9.1911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003017	2223547	MAG	China	Asia

• Gene Location: Start: 17480; End: 18637 Strand: -

Full Sequence      

MTSRRVFLERLALMCAAACAGSSSVSAKSTRRRKQWLALWQGFVAGAVHNGRVIDVSDKR
LITTSEGQSYAMFFSLVAGDRALFDALWQWTQNNLCAGDCGKTLPAWLWGRLSDTRNPKT
RRLEEHWDVIDDNNAVDADLWIAYSLLEASRLWRVDDYRTQALSLLELVKKQCVRTVGTL
GSVCLPAKRGFQHEDGSVTLNPSYYPLQLMQRFCREDAAWQGIARSTLRALLRSSPTGIV
PDWARFNARGLLLATDRDSGSWDAIRTYMWAGMLASDVPERAMLLERFQNAYGFVKARMG
PIGRVNAPRLSVGSPGPDAFVAAFLSWNPQSSEAAMMRSLLESVPIDAQNYYKSMLTLFG
RGFDDGCFAFDRYGRLLLATSGKEA

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	362	2.9e-72	0.9875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	3.49e-115	39	379	27	367	cellulase.
COG3405	BcsZ	1.47e-70	23	370	16	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.17e-48	50	366	19	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	8.04e-101	39	384	26	366
QQS88762.1	4.88e-97	39	378	30	361
QDA53782.1	5.83e-93	33	377	68	408
QEU29339.1	4.57e-86	40	378	26	359
AYN94862.1	6.46e-86	35	378	22	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	6.93e-82	40	381	7	344	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXQ_A	1.82e-74	40	377	7	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	3.14e-71	40	376	11	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	1.40e-70	40	377	7	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F82_A	4.92e-70	40	376	11	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	2.33e-75	25	377	14	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	3.67e-74	25	377	14	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	1.18e-72	40	377	29	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	2.34e-72	40	377	29	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	1.64e-66	39	379	35	374	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000802	0.001841	0.010977	0.726425	0.259920	0.000029

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003017_01607.