CAZyme Information: MGYG000003018_00230

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_00230
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		73780.88	4.9659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 8587; End: 10569 Strand: +

Full Sequence      

MLALGAVLSAPTAYGLTKKADKPQTESTVRVADALVPAPYGSTHMGGYLGDKLDLCIANR
LMAQDVERVVQPFRDKPDGSWGFRSEFWGKWYTAAVMGYAYAPTPENRAVIDRAVQELIA
TQDGNGYIGTYQDENHLGEWDIWGRKYVMLGLLGYYDQTGDRAALESAMKVADHLIAEAG
PDSGVNIAATGWIGWKGLASSSVLEPIALLYEKTGEQRYLDFARHIIRSWDTPNRLSPTG
IRLVQEALNGTPLWKMSGAPKAYEMMSCFEGLCEMYRITGDRLYFDACHKLIETIIRDEI
MIVGSGSMAEIWCHGKMRQTEPMYQGMETCVTATWMKFLYQMLRLTGDSRYADQLETSLY
NALLGSMAPQGEWWSYYASLMGERVHSHQQFPDVVMSCCVANGPRGLMITPSWAVMTDRE
GAVVNLYGRMNSTVQTPAGRPLSIAMESDYPVEGLVSTEIGLERSETFALSFRIPEWSAD
TKIRINGKPYEGYLVPGTYASIRREWNGGDKVEIELDMRARAVDAPSGVGDKAIVRGPVV
LAFDSRLIPRRDGVTEPPMYRYEFLSDAEGYVDVQKVSDAGVPALWMAFDVPCVDEAGGR
HTMRMCDYASAGNSWTEGNIFRVWTPQPFDFRHLYTNNLDWHVNVTVGVDRPEVPEIYRK

Enzyme Prediction     

No EC number prediction in MGYG000003018_00230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	83	541	4.2e-61	0.898854961832061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.85e-68	81	542	53	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.14e-65	28	544	2	503	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	6.38e-07	150	228	93	173	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG4225	YesR	5.17e-04	138	240	32	121	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04792	LanM-like	6.33e-04	150	228	599	681	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.03e-117	47	627	31	608
QOY86860.1	1.59e-44	90	544	97	551
QHS51661.1	3.81e-42	90	544	123	582
ACM22580.1	7.41e-42	35	540	17	532
ACZ43114.1	1.86e-40	90	545	87	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WRE_A	1.21e-32	90	613	80	646	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.28e-32	90	613	80	646	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	3.06e-32	90	613	80	646	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	3.95e-29	90	613	80	646	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]
5MQO_A	8.11e-29	47	545	49	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.63e-32	90	613	80	646	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.020135	0.978572	0.000345	0.000419	0.000275	0.000233

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_00230.